LXL04_014306 | RubberDandelionOmics

Gene overview

LXL04_014306

Reference: OH-1004 Chr: Chr03 Coordinates: 45803286-45807141 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3774 bp · LXL04_014306|LXL04_014306|OH1004|cDNA

ATGGCGAAACAGGTGTTGCGATTTCTTACTCTGTTTTTTGTTGGTTTTTTTCTGTTTGGGTATGTGGAGTCTGGGAATACAGATACTGCTACGACTTTTAAAATTCTTCTTGAGGTTAAGCGATCGATCACTGAAGACCCACAAAATGTTCTGAAAAGTTGGTCGGAGAAAAACCAGAGTTTCTGTGACTGGTATGGTGTTACTTGTGCCGGAAACTTTTCTCAGGTGGTGGGTCTCAACCTCTCCAGTTCTTCGTTGGG...

CDS

Download CDS FASTA

3774 bp · LXL04_014306|LXL04_014306|OH1004|CDS

ATGGCGAAACAGGTGTTGCGATTTCTTACTCTGTTTTTTGTTGGTTTTTTTCTGTTTGGGTATGTGGAGTCTGGGAATACAGATACTGCTACGACTTTTAAAATTCTTCTTGAGGTTAAGCGATCGATCACTGAAGACCCACAAAATGTTCTGAAAAGTTGGTCGGAGAAAAACCAGAGTTTCTGTGACTGGTATGGTGTTACTTGTGCCGGAAACTTTTCTCAGGTGGTGGGTCTCAACCTCTCCAGTTCTTCGTTGGG...

Protein

Download Protein FASTA

1257 aa · LXL04_014306|LXL04_014306|OH1004|PROTEIN

MAKQVLRFLTLFFVGFFLFGYVESGNTDTATTFKILLEVKRSITEDPQNVLKSWSEKNQSFCDWYGVTCAGNFSQVVGLNLSSSSLGGGISPSISLLQNLLHLDLSSNQLTGPIPPNISALTSLSSLLLFSNQLTGHIPAELGSLSSLVMLRIGDNGLTGPIPSSLGGLQNLRVLGLASCYLSGQIPPELGKLKSLENLVIQENELEGPIPPEVGNCSSLLAFTAAVNHLNGSIPDELCDLKKLQTLNLANNSLSGEIPR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014306`
TK1151 ID	TkA02G440390
OH-1004 ID	LXL04_014306
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.900
Protein coverage (%)	TK1151 68.276 / OH-1004 7.717 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014306

Location Chr03:45803286-45807141 (+)

Description Similar to GSO1: LRR receptor-like serine/threonine-protein kinase GSO1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
`At5g44700`	Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
`At5g63930`	Probable leucine-rich repeat receptor-like protein kinase At5g63930.	No verified direct reference in this release
`At1g17230`	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230.	No verified direct reference in this release
`At2g33170`	Probable leucine-rich repeat receptor-like protein kinase At2g33170.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014306 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009553 embryo sac development Biological Process

GO:0009611 response to wounding Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0045184 establishment of protein localization Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0090708 specification of plant organ axis polarity Biological Process

GO:0160073 Casparian strip assembly Biological Process

GO:2000067 regulation of root morphogenesis Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT4G20140

ath:AT5G44700

ath:AT5G63930

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.875

Rank 1 · LXL04_014306 · OH-1004

Endoplasmic reticulum0.083

Rank 2 · LXL04_014306 · OH-1004

Cytoplasm0.057

Rank 3 · LXL04_014306 · OH-1004

Nucleus0.037

Rank 4 · LXL04_014306 · OH-1004

Lysosome / Vacuole0.025

Rank 5 · LXL04_014306 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_235-69 aa

PF23598.2LRR_1489-177 aa

PF23598.2LRR_14165-251 aa

PF23598.2LRR_14235-322 aa

PF13855.13LRR_8240-278 aa

PF24141.2LRR_ComC240-336 aa

PF12799.14LRR_4242-280 aa

PF13855.13LRR_8267-326 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014306	`PF08263.18`	LRRNT_2	35	69	1.4e-08	35.6
LXL04_014306	`PF23598.2`	LRR_14	89	177	2.2e-47	162.3
LXL04_014306	`PF23598.2`	LRR_14	165	251	2.2e-47	162.3
LXL04_014306	`PF23598.2`	LRR_14	235	322	2.2e-47	162.3
LXL04_014306	`PF13855.13`	LRR_8	240	278	1.3e-56	188.9
LXL04_014306	`PF24141.2`	LRR_ComC	240	336	1.6e-15	58.3
LXL04_014306	`PF12799.14`	LRR_4	242	280	1.3e-47	159.5
LXL04_014306	`PF13855.13`	LRR_8	267	326	1.3e-56	188.9
LXL04_014306	`PF23598.2`	LRR_14	345	441	2.2e-47	162.3
LXL04_014306	`PF13855.13`	LRR_8	380	424	1.3e-56	188.9
LXL04_014306	`PF12799.14`	LRR_4	389	423	1.3e-47	159.5
LXL04_014306	`PF23598.2`	LRR_14	456	566	2.2e-47	162.3
LXL04_014306	`PF13855.13`	LRR_8	510	568	1.3e-56	188.9
LXL04_014306	`PF23598.2`	LRR_14	616	707	2.2e-47	162.3
LXL04_014306	`PF12799.14`	LRR_4	629	664	1.3e-47	159.5
LXL04_014306	`PF13855.13`	LRR_8	648	687	1.3e-56	188.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGQ5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO1	61.664%	Swiss-Prot	strong database homology
`Q9FIZ3`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO2	57.257%	Swiss-Prot	strong database homology
`Q9LVP0`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g63930	39.197%	Swiss-Prot	moderate database homology
`Q9SHI2`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	37.066%	Swiss-Prot	moderate database homology
`O49318`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At2g33170	38.275%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card