LXL04_014268 | RubberDandelionOmics

Gene overview

LXL04_014268

Reference: OH-1004 Chr: Chr03 Coordinates: 45029652-45030532 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

444 bp · LXL04_014268|LXL04_014268|OH1004|cDNA

ATGTCGACAAGCGGATGGTTCAGGCCCACAATCGGAAGAACATCACCTCCAATTCCAAATCGTTCGCTCAATCTCAAATCCTCAAACCTACGTGCTTGTTTCATCGAATACCCTCTAGCTAGCAAGATCATCGTCAGAAATTTGTCGTACTCCACGAGTGAAAGCTGTTTAAAGGAAGAGTTTTCTAATTTCGGGAAAATAGCTGAAGTTAAGCTTGTTAAAGATGAAAACACAAAGAAATCAAAAGGGTATGCGTTTGT...

CDS

Download CDS FASTA

444 bp · LXL04_014268|LXL04_014268|OH1004|CDS

ATGTCGACAAGCGGATGGTTCAGGCCCACAATCGGAAGAACATCACCTCCAATTCCAAATCGTTCGCTCAATCTCAAATCCTCAAACCTACGTGCTTGTTTCATCGAATACCCTCTAGCTAGCAAGATCATCGTCAGAAATTTGTCGTACTCCACGAGTGAAAGCTGTTTAAAGGAAGAGTTTTCTAATTTCGGGAAAATAGCTGAAGTTAAGCTTGTTAAAGATGAAAACACAAAGAAATCAAAAGGGTATGCGTTTGT...

Protein

Download Protein FASTA

147 aa · LXL04_014268|LXL04_014268|OH1004|PROTEIN

MSTSGWFRPTIGRTSPPIPNRSLNLKSSNLRACFIEYPLASKIIVRNLSYSTSESCLKEEFSNFGKIAEVKLVKDENTKKSKGYAFVQYTNQDDAMSALETMDDKYLDGRVILVELAKPVRTRQSGYPKTSGPPQISPIPGQMEMEH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014268`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014268

Location Chr03:45029652-45030532 (+)

Description Similar to S-RBP11: Small RNA-binding protein 11, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06210`	Probable RNA-binding protein that may be involved in salt and oxidative stress tolerance.	The Arabidopsis chloroplast protein S-RBP11 is involved in oxidative and salt stress responses.2014 · DOI: 10.1007/s00299-013-1560-9
`At3g23830`	Possibly has a role in RNA transcription or processing during stress.	Characterization of transgenic Arabidopsis plants overexpressing GR-RBP4 under high salinity, dehydration, or cold stress.2005 · DOI: 10.1093/jxb/eri298
`At1g73530`	Involved in C-to-U editing of chloroplastic RNA.	An Organelle RNA Recognition Motif Protein Is Required for Photosystem II Subunit psbF Transcript Editing.2017 · DOI: 10.1104/pp.16.01623

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014268 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006858 extracellular transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009411 response to UV Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0016477 cell migration Biological Process

GO:0016554 cytidine to uridine editing Biological Process

GO:0030308 negative regulation of cell growth Biological Process

GO:0034063 stress granule assembly Biological Process

KEGG gene cross-reference

ath:AT1G73530

ath:AT3G23830

ath:AT5G06210

rno:81825

xla:379761

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.874

Rank 1 · LXL04_014268 · OH-1004

Mitochondrion0.120

Rank 2 · LXL04_014268 · OH-1004

Nucleus0.038

Rank 3 · LXL04_014268 · OH-1004

Cytoplasm0.019

Rank 4 · LXL04_014268 · OH-1004

Cell membrane0.008

Rank 5 · LXL04_014268 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076.29RRM_143-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014268	`PF00076.29`	RRM_1	43	112	3.4e-23	82.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFZ6`	Arabidopsis thaliana	Small RNA-binding protein 11, chloroplastic	36.449%	Swiss-Prot	moderate database homology
`Q9LIS2`	Arabidopsis thaliana	Glycine-rich RNA-binding protein 4, mitochondrial	38.710%	Swiss-Prot	moderate database homology
`Q9FX45`	Arabidopsis thaliana	Organelle RRM domain-containing protein 6, chloroplastic	37.374%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card