LXL04_014044 | RubberDandelionOmics

Gene overview

LXL04_014044

Reference: OH-1004 Chr: Chr03 Coordinates: 41089088-41090932 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

960 bp · LXL04_014044|LXL04_014044|OH1004|cDNA

ATGGCATCTCTGGATATGTCACTCGATGATATGATTAAAAACAGGCGTAATACAGATAGAGGGAGAGGTAGAGGCAGAGGTAGAGGTCGTGGTGGCCGAGGTCAAGGAAGATCTTTTGGTGGTGGAAGAACAACAACAGGGCCACCTCGCAGAGGTCCCCTTGCTGTGAAGGCTCGGCCCTCATCTTATACTATTGCAAAGGCAAGCTTAAATCCATGGATATCTTATGCATTCGCTCTTATCGGAGTTACATGTAGTTA...

CDS

Download CDS FASTA

960 bp · LXL04_014044|LXL04_014044|OH1004|CDS

ATGGCATCTCTGGATATGTCACTCGATGATATGATTAAAAACAGGCGTAATACAGATAGAGGGAGAGGTAGAGGCAGAGGTAGAGGTCGTGGTGGCCGAGGTCAAGGAAGATCTTTTGGTGGTGGAAGAACAACAACAGGGCCACCTCGCAGAGGTCCCCTTGCTGTGAAGGCTCGGCCCTCATCTTATACTATTGCAAAGGCAAGCTTAAATCCATGGATATCTTATGCATTCGCTCTTATCGGAGTTACATGTAGTTA...

Protein

Download Protein FASTA

319 aa · LXL04_014044|LXL04_014044|OH1004|PROTEIN

MASLDMSLDDMIKNRRNTDRGRGRGRGRGRGGRGQGRSFGGGRTTTGPPRRGPLAVKARPSSYTIAKASLNPWISYAFALIGVTCSYCSMASCVIGYIYTLRYHSFRRPKIFNWQQGLFEDSLKAVGLPGFDNGARLNVSNLDIGVTNEDIRELFSEIGELKRYAIHYDKNGRPSGSAEVLFARRSDAFQALKRYNNVQLDGKPMKIEIENSTSEMMPLSARVNVVGGRNGQRTVVMTSGGGRGRGGAVAANRSFGQRIR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014044`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014044

Location Chr03:41089088-41090932 (+)

Description Similar to ALY4: THO complex subunit 4D

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g37720`	Export adapter involved in nuclear export of spliced and unspliced mRNA.	Arabidopsis coactivator ALY-like proteins, DIP1 and DIP2, interact physically with the DNA-binding domain of the Zn-finger poly(ADP-ribose) polymerase.2001 · DOI: 10.1093/jxb/52.359.1375 ALY proteins participate in multifaceted Nep1Mo-triggered responses in Nicotiana benthamiana and Arabidopsis thaliana.2014 · DOI: 10.1093/jxb/eru136
`At1g66260`	Export adapter involved in nuclear export of spliced and unspliced mRNA.	Arabidopsis coactivator ALY-like proteins, DIP1 and DIP2, interact physically with the DNA-binding domain of the Zn-finger poly(ADP-ribose) polymerase.2001 · DOI: 10.1093/jxb/52.359.1375
`At5g59950`	Export adapter involved in nuclear export of spliced and unspliced mRNA.	No verified direct reference in this release
`At5g02530`	Export adapter involved in nuclear export of spliced and unspliced mRNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014044 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006405 RNA export from nucleus Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0006952 defense response Biological Process

GO:0008380 RNA splicing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G66260

ath:AT5G02530

ath:AT5G37720

ath:AT5G59950

xtr:549781

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.884

Rank 1 · LXL04_014044 · OH-1004

Cytoplasm0.201

Rank 2 · LXL04_014044 · OH-1004

Cell membrane0.018

Rank 3 · LXL04_014044 · OH-1004

Mitochondrion0.016

Rank 4 · LXL04_014044 · OH-1004

Endoplasmic reticulum0.014

Rank 5 · LXL04_014044 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076.29RRM_1139-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014044	`PF00076.29`	RRM_1	139	205	1.3e-11	45.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NQ72`	Arabidopsis thaliana	THO complex subunit 4D	54.497%	Swiss-Prot	moderate database homology
`Q94EH8`	Arabidopsis thaliana	THO complex subunit 4C	61.789%	Swiss-Prot	weak database homology
`Q8L773`	Arabidopsis thaliana	THO complex subunit 4A	39.130%	Swiss-Prot	moderate database homology
`Q8L719`	Arabidopsis thaliana	THO complex subunit 4B	57.282%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card