LXL04_013215 | RubberDandelionOmics

Gene overview

LXL04_013215

Reference: OH-1004 Chr: Chr03 Coordinates: 26120545-26122890 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1182 bp · LXL04_013215|LXL04_013215|OH1004|cDNA

ATGCCAGGAATCAGATCACCATCTGACTATTCAGAAGAACCGAAACGACATCCTGCTCTCAAAATCAACGCTAAGGAGCCCTTCAATGCGGAACCAAGACGTCAGGATTTGGTTTCTTCTTATATCACCCCTACGGAATTCTTCTACAAGAGAAACCATGGACCAATACCTGTTGTGGATGATATAGAAAGATATTGCGTCTCTGTTAATGGGCTAATTAACAAACCCAAAGATCTGTTTATGAAAGATATCATGAACCT...

CDS

Download CDS FASTA

1182 bp · LXL04_013215|LXL04_013215|OH1004|CDS

ATGCCAGGAATCAGATCACCATCTGACTATTCAGAAGAACCGAAACGACATCCTGCTCTCAAAATCAACGCTAAGGAGCCCTTCAATGCGGAACCAAGACGTCAGGATTTGGTTTCTTCTTATATCACCCCTACGGAATTCTTCTACAAGAGAAACCATGGACCAATACCTGTTGTGGATGATATAGAAAGATATTGCGTCTCTGTTAATGGGCTAATTAACAAACCCAAAGATCTGTTTATGAAAGATATCATGAACCT...

Protein

Download Protein FASTA

393 aa · LXL04_013215|LXL04_013215|OH1004|PROTEIN

MPGIRSPSDYSEEPKRHPALKINAKEPFNAEPRRQDLVSSYITPTEFFYKRNHGPIPVVDDIERYCVSVNGLINKPKDLFMKDIMNLPKYTVTATLQCAGNRRTAMSKTRTVRGVGWDVSALGNAIWGGAKLADVLELVGIPKLTSTTPTGGKHVEFVSIDKCKEEKGGPYKASIPLSVATNPEADVLLAYEMNGETLNRDHGYPLRVVVPGVIGARSVKWLDSINIDSQVCQGFFMQKDYKMFPPTVNWDNIDWSTRRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013215`
TK1151 ID	TkA02G511160
OH-1004 ID	LXL04_013215
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013215

Location Chr03:26120545-26122890 (+)

Description Similar to SOX: Sulfite oxidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01910`	Probably involved in sulfite oxidative detoxification.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013215 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006790 sulfur compound metabolic process Biological Process

GO:0007584 response to nutrient Biological Process

GO:0010477 response to sulfur dioxide Biological Process

GO:0015994 chlorophyll metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008482 sulfite oxidase activity Molecular Function

GO:0020037 heme binding Molecular Function

GO:0030151 molybdenum ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G01910

mmu:211389

rno:81805

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.416

Rank 1 · LXL04_013215 · OH-1004

Plastid0.234

Rank 2 · LXL04_013215 · OH-1004

Peroxisome0.149

Rank 3 · LXL04_013215 · OH-1004

Nucleus0.123

Rank 4 · LXL04_013215 · OH-1004

Mitochondrion0.087

Rank 5 · LXL04_013215 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00174.26Oxidored_molyb53-235 aa

PF03404.23Mo-co_dimer260-388 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013215	`PF00174.26`	Oxidored_molyb	53	235	1.8e-54	184.5
LXL04_013215	`PF03404.23`	Mo-co_dimer	260	388	1.3e-37	129.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S850`	Arabidopsis thaliana	Sulfite oxidase	76.336%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card