LXL04_012981 | RubberDandelionOmics

Gene overview

LXL04_012981

Reference: OH-1004 Chr: Chr03 Coordinates: 21858662-21865978 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6873 bp · LXL04_012981|LXL04_012981|OH1004|cDNA

ATGGACCAATTCACAAATCTGCATCCATGTATGCCTCTAAACACAAGAATCTGCATAATTGGAGGTGGTCCAAGTGGTTTATCAGCAGCCTATGCACTTTCAAAACTCGGTTACAACAATGTAACCCTCCTAGAAAAATACCACACAGTCAGTGGCATGTGTGAGTCAGCTGACATTGAAGGAAAAATCTATGATCTTGGAGGCCAAGTTCTTGCAGCAAACAGTGCCCCTACTGTTTTCCACCTGGCAAAAGAACTCGG...

CDS

Download CDS FASTA

6873 bp · LXL04_012981|LXL04_012981|OH1004|CDS

ATGGACCAATTCACAAATCTGCATCCATGTATGCCTCTAAACACAAGAATCTGCATAATTGGAGGTGGTCCAAGTGGTTTATCAGCAGCCTATGCACTTTCAAAACTCGGTTACAACAATGTAACCCTCCTAGAAAAATACCACACAGTCAGTGGCATGTGTGAGTCAGCTGACATTGAAGGAAAAATCTATGATCTTGGAGGCCAAGTTCTTGCAGCAAACAGTGCCCCTACTGTTTTCCACCTGGCAAAAGAACTCGG...

Protein

Download Protein FASTA

2290 aa · LXL04_012981|LXL04_012981|OH1004|PROTEIN

MDQFTNLHPCMPLNTRICIIGGGPSGLSAAYALSKLGYNNVTLLEKYHTVSGMCESADIEGKIYDLGGQVLAANSAPTVFHLAKELGSELEEMDNHKLALIDSSTGKFEDINVADDYVSVIPLAFELQDKVKKSGRNGVHAISEFASEPVPEFLESKGLKNVPKSVAYGYTASGYGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYMKFWQKLSNSLPINIKCNTEVVSINRTPSCVYVHTINTSKEVKVMEFDKIIISGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012981`
TK1151 ID	TkA02G525390
OH-1004 ID	LXL04_012981
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 26.332 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_012981`
Location	Chr03:21858662-21865978 (+)
Description	Similar to fadD29: 4-hydroxyphenylalkanoate adenylyltransferase (Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012981` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006633 fatty acid biosynthetic process Biological Process GO:0008610 lipid biosynthetic process Biological Process GO:0097040 phthiocerol biosynthetic process Biological Process GO:0005886 plasma membrane Cellular Component GO:0005524 ATP binding Molecular Function GO:0016874 ligase activity Molecular Function GO:0016878 acid-thiol ligase activity Molecular Function GO:0070566 adenylyltransferase activity Molecular Function
KEGG gene cross-reference	ag:AAS98774 mbo:BQ2027_MB2955 mbo:BQ2027_MB2974C mmi:MMAR_1759 mtu:Rv2950c mtv:RVBD_2950c These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.299

Rank 1 · LXL04_012981 · OH-1004

Endoplasmic reticulum0.199

Rank 2 · LXL04_012981 · OH-1004

Plastid0.151

Rank 3 · LXL04_012981 · OH-1004

Cytoplasm0.148

Rank 4 · LXL04_012981 · OH-1004

Peroxisome0.101

Rank 5 · LXL04_012981 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01266.31DAO16-51 aa

PF13450.13NAD_binding_819-86 aa

PF01593.31Amino_oxidase25-261 aa

PF00501.35AMP-binding502-900 aa

PF23024.2AMP-dom_DIP2-like944-1067 aa

PF00550.32PP-binding1116-1179 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012981	`PF01266.31`	DAO	16	51	1.2e-06	29.1
LXL04_012981	`PF13450.13`	NAD_binding_8	19	86	9.9e-13	48.9
LXL04_012981	`PF01593.31`	Amino_oxidase	25	261	1.2e-12	48.6
LXL04_012981	`PF00501.35`	AMP-binding	502	900	1.7e-59	202.3
LXL04_012981	`PF23024.2`	AMP-dom_DIP2-like	944	1067	7.8e-07	29.8
LXL04_012981	`PF00550.32`	PP-binding	1116	1179	6.9e-09	36.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card