Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1167 bp · LXL04_012884|LXL04_012884|OH1004|cDNA
ATGGAAGGCGGTGTCGCGGCGGAGCAAGGAACGGTGACTTGTGCGTCATGGATCAAGCGGCCGGAGAATGCGCATCTAGTTGCCTTAGGGAAGTTGAAGCACGAAAATCACCCTGCCTCTTTCCAAATTTTCTCTTTCGATCATCTCACCACATCTCTCTCGTCCTCTCCGTCGGCCAGTTTCGAGTTTGAAGATGGATGTGATCCAGTGAGCCTCGCGGTGCATCCGAGCGGTGACGATATTGTCTGCTCTACTACCAA...
1167 bp · LXL04_012884|LXL04_012884|OH1004|CDS
ATGGAAGGCGGTGTCGCGGCGGAGCAAGGAACGGTGACTTGTGCGTCATGGATCAAGCGGCCGGAGAATGCGCATCTAGTTGCCTTAGGGAAGTTGAAGCACGAAAATCACCCTGCCTCTTTCCAAATTTTCTCTTTCGATCATCTCACCACATCTCTCTCGTCCTCTCCGTCGGCCAGTTTCGAGTTTGAAGATGGATGTGATCCAGTGAGCCTCGCGGTGCATCCGAGCGGTGACGATATTGTCTGCTCTACTACCAA...
Protein
Download Protein FASTA388 aa · LXL04_012884|LXL04_012884|OH1004|PROTEIN
MEGGVAAEQGTVTCASWIKRPENAHLVALGKLKHENHPASFQIFSFDHLTTSLSSSPSASFEFEDGCDPVSLAVHPSGDDIVCSTTKGGCRLFQLYVQEKSVKLLYKDLKPLQDVGPQKCLAFSTDGSKFATGGVDGHLRIYEWPSMRVIADHQRAHPGFSDMDFSLDSEFLATTSTDGSGRIWNANDGVPVNSLTRNSDEKIELCRFSKDGTKPFLFCTVQKGNKSVTVVYDISTWNKIGFKRLLRKPACVMSISLDGK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_012884 |
|---|---|
| TK1151 ID | TkA02G532530 |
| OH-1004 ID | LXL04_012884 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_012884 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:20387260-20389447 (-) | |||||||||
| Description | Similar to PHF1: SEC12-like protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0003400 regulation of COPII vesicle coating Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006817 phosphate ion transport Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0008380 RNA splicing Biological Process GO:0015031 protein transport Biological Process GO:0016036 cellular response to phosphate starvation Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0048208 COPII vesicle coating Biological Process GO:0090110 COPII-coated vesicle cargo loading Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G01470 ath:AT3G52190 gga:427377 mmu:50907 rno:58842 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF25174.2Beta-prop_THOC368-213 aaPF24796.2WDR5569-224 aaPF23414.2Beta-prop_EML_271-213 aaPF24814.2WD40_Prp1971-239 aaPF25172.2Beta-prop_WDR3_2nd103-271 aaPF24817.2WD40_WDHD1_1st117-197 aaPF24817.2WD40_WDHD1_1st117-306 aaPF25173.2Beta-prop_WDR3_1st119-201 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_012884 | PF25174.2 | Beta-prop_THOC3 | 68 | 213 | 3.2e-20 | 73.0 |
| LXL04_012884 | PF24796.2 | WDR55 | 69 | 224 | 4.3e-12 | 46.4 |
| LXL04_012884 | PF23414.2 | Beta-prop_EML_2 | 71 | 213 | 2e-20 | 74.0 |
| LXL04_012884 | PF24814.2 | WD40_Prp19 | 71 | 239 | 1.1e-16 | 61.5 |
| LXL04_012884 | PF25172.2 | Beta-prop_WDR3_2nd | 103 | 271 | 9.9e-07 | 29.0 |
| LXL04_012884 | PF24817.2 | WD40_WDHD1_1st | 117 | 197 | 2.1e-20 | 73.8 |
| LXL04_012884 | PF24817.2 | WD40_WDHD1_1st | 117 | 306 | 2.1e-20 | 73.8 |
| LXL04_012884 | PF25173.2 | Beta-prop_WDR3_1st | 119 | 201 | 6e-11 | 43.1 |
| LXL04_012884 | PF23381.2 | Beta-prop_IFT122_1st | 120 | 213 | 7.6e-17 | 62.3 |
| LXL04_012884 | PF25175.2 | Beta-prop_WDR5 | 120 | 312 | 2.6e-16 | 60.5 |
| LXL04_012884 | PF24814.2 | WD40_Prp19 | 154 | 311 | 1.1e-16 | 61.5 |
| LXL04_012884 | PF24807.2 | WD40_CDC20-Fz | 161 | 309 | 2.2e-12 | 47.6 |
| LXL04_012884 | PF24805.2 | EIF3I | 162 | 321 | 4.3e-14 | 53.1 |
| LXL04_012884 | PF23414.2 | Beta-prop_EML_2 | 174 | 318 | 2e-20 | 74.0 |
| LXL04_012884 | PF25174.2 | Beta-prop_THOC3 | 225 | 306 | 3.2e-20 | 73.0 |
| LXL04_012884 | PF23381.2 | Beta-prop_IFT122_1st | 250 | 309 | 7.6e-17 | 62.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.