LXL04_012876 | RubberDandelionOmics

Gene overview

LXL04_012876

Reference: OH-1004 Chr: Chr03 Coordinates: 20242251-20243802 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

924 bp · LXL04_012876|LXL04_012876|OH1004|cDNA

ATGCTCGCCGGTGTTATTTCTTCACGTCCGAAATCTTGGCTTGTTGGCTCACCACTCGCTCACTACGCCTTGGCGGCTCGTCACCGTCACATCCCCTCCGATGCCAGTTTTCCGGTTAAACTACTTCTCCCTGCGACGGACGCTCTCGACCGTCGCCGGTTTCCTTACCATTCAATAGCTACCGGATTGAATTTCTCGGCGTCCGCCATATCCGCATCCGCATGGCATGCTATCATTCCGACCGGAAACGGTCGGGGAAA...

CDS

Download CDS FASTA

924 bp · LXL04_012876|LXL04_012876|OH1004|CDS

ATGCTCGCCGGTGTTATTTCTTCACGTCCGAAATCTTGGCTTGTTGGCTCACCACTCGCTCACTACGCCTTGGCGGCTCGTCACCGTCACATCCCCTCCGATGCCAGTTTTCCGGTTAAACTACTTCTCCCTGCGACGGACGCTCTCGACCGTCGCCGGTTTCCTTACCATTCAATAGCTACCGGATTGAATTTCTCGGCGTCCGCCATATCCGCATCCGCATGGCATGCTATCATTCCGACCGGAAACGGTCGGGGAAA...

Protein

Download Protein FASTA

307 aa · LXL04_012876|LXL04_012876|OH1004|PROTEIN

MLAGVISSRPKSWLVGSPLAHYALAARHRHIPSDASFPVKLLLPATDALDRRRFPYHSIATGLNFSASAISASAWHAIIPTGNGRGKHNLRPAGEGSWNVAWDVRPARWLHRPYTAWLLFGICACLAVAAPPVEFNDTSSEPINIIADDNKINVSCTTTISEKSTNYKITGVPADGRCLFRAIAHMVCLRNGEEAPDENRQRELADELRAQVVDELLKRQKEIEWFIEGDFEAYVKTIEKPHVWGGEPELLMASHILKTK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012876`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012876

Location Chr03:20242251-20243802 (+)

Description Similar to OTU4: OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57810`	Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation.	No verified direct reference in this release
`At2g38025`	Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation.	Distinct phylogenetic relationships and biochemical properties of Arabidopsis ovarian tumor-related deubiquitinases support their functional differentiation.2014 · DOI: 10.3389/fpls.2014.00084

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012876 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006307 DNA alkylation repair Biological Process

GO:0006508 proteolysis Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0034122 negative regulation of toll-like receptor signaling pathway Biological Process

GO:0035871 protein K11-linked deubiquitination Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0070536 protein K63-linked deubiquitination Biological Process

GO:0071108 protein K48-linked deubiquitination Biological Process

GO:0140374 antiviral innate immune response Biological Process

GO:1903093 regulation of protein K48-linked deubiquitination Biological Process

GO:2000660 negative regulation of interleukin-1-mediated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT2G38025

ath:AT3G57810

hsa:54726

xla:444600

xtr:496720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.913

Rank 1 · LXL04_012876 · OH-1004

Mitochondrion0.089

Rank 2 · LXL04_012876 · OH-1004

Cytoplasm0.051

Rank 3 · LXL04_012876 · OH-1004

Nucleus0.046

Rank 4 · LXL04_012876 · OH-1004

Cell membrane0.021

Rank 5 · LXL04_012876 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02338.26OTU173-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012876	`PF02338.26`	OTU	173	301	2.8e-24	86.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBZ4`	Arabidopsis thaliana	OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 4	59.286%	Swiss-Prot	weak database homology
`Q8GYW0`	Arabidopsis thaliana	OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 3	29.545%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card