LXL04_012518 | RubberDandelionOmics

Gene overview

LXL04_012518

Reference: OH-1004 Chr: Chr03 Coordinates: 13619232-13623340 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3537 bp · LXL04_012518|LXL04_012518|OH1004|cDNA

ATGCCGCCGGAGCCATTGCCATTCGACCGGAAGGAGTTTTTGAAGGATAGGAAGCCGTCGTCATCGGACGCTGTAGAAATTGTTCCACAGCGATGGATAGATCCGGCTACTACTCCTTCGCAGTATCGCAACCATGGATCCTCTTTGTCTTGTCGgtggggcggtggaggtggacCTTCTGATTTCCGTCAACCCTTTTCCGGTCTTCTTGGTAAGCGAGCTAGTGGTGGCTGGCACACTGCAACAGTTGAATCAGGCAA...

CDS

Download CDS FASTA

3537 bp · LXL04_012518|LXL04_012518|OH1004|CDS

ATGCCGCCGGAGCCATTGCCATTCGACCGGAAGGAGTTTTTGAAGGATAGGAAGCCGTCGTCATCGGACGCTGTAGAAATTGTTCCACAGCGATGGATAGATCCGGCTACTACTCCTTCGCAGTATCGCAACCATGGATCCTCTTTGTCTTGTCGGTGGGGCGGTGGAGGTGGACCTTCTGATTTCCGTCAACCCTTTTCCGGTCTTCTTGGTAAGCGAGCTAGTGGTGGCTGGCACACTGCAACAGTTGAATCAGGCAA...

Protein

Download Protein FASTA

1178 aa · LXL04_012518|LXL04_012518|OH1004|PROTEIN

MPPEPLPFDRKEFLKDRKPSSSDAVEIVPQRWIDPATTPSQYRNHGSSLSCRWGGGGGPSDFRQPFSGLLGKRASGGWHTATVESGNKENSVSMAFGSQKDLKGAISCEPSASPNGNSLPHNDFVNSSDQLQSVDQHAKNSGGGGFSTTSSQRLEKENSLGSWKHLKWIRSGSLSSRGSGLSHSSGCKIIGVMDPFNITPLRSPSEDSSAPCLTPRTPDDATSRKKQRLGWGEGLAKYEKKKVDPEDALDKEIRARNGSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012518`
TK1151 ID	TkA02G556680
OH-1004 ID	LXL04_012518
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 71.756 / OH-1004 7.980 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_012518`
Location	Chr03:13619232-13623340 (-)
Description	Similar to NCOR2: Nuclear receptor corepressor 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012518` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006325 chromatin organization Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0010467 gene expression Biological Process GO:0010565 regulation of ketone metabolic process Biological Process GO:0032355 response to estradiol Biological Process GO:0042593 glucose homeostasis Biological Process GO:0045820 negative regulation of glycolytic process Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0045922 negative regulation of fatty acid metabolic process Biological Process GO:0046329 negative regulation of JNK cascade Biological Process GO:0048511 rhythmic process Biological Process
KEGG gene cross-reference	hsa:9611 hsa:9612 mmu:20602 xla:398304 xtr:613105 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · LXL04_012518 · OH-1004

Cytoplasm0.092

Rank 2 · LXL04_012518 · OH-1004

Cell membrane0.026

Rank 3 · LXL04_012518 · OH-1004

Endoplasmic reticulum0.011

Rank 4 · LXL04_012518 · OH-1004

Plastid0.010

Rank 5 · LXL04_012518 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding651-693 aa

PF25826.2DUF7952652-713 aa

PF13921.13Myb_DNA-bind_6652-696 aa

PF00249.38Myb_DNA-binding857-897 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012518	`PF00249.38`	Myb_DNA-binding	651	693	4.1e-19	69.2
LXL04_012518	`PF25826.2`	DUF7952	652	713	1.1e-10	42.5
LXL04_012518	`PF13921.13`	Myb_DNA-bind_6	652	696	2.7e-08	34.6
LXL04_012518	`PF00249.38`	Myb_DNA-binding	857	897	4.1e-19	69.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card