LXL04_012437 | RubberDandelionOmics

Gene overview

LXL04_012437

Reference: OH-1004 Chr: Chr03 Coordinates: 12227318-12228513 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

675 bp · LXL04_012437|LXL04_012437|OH1004|cDNA

ATGAATGAAGcatcctcctcctcctcatcctTACCTCAGCAATTTGAAGAAACAATAGAGGAGAACAAAATAAATTTCTTTAGCAACGACTTGCATATCGAACCAGAATCGTACAACTACTACCAGCAGCCTGATCATAGACCCATTGGTACTGTTCCTCTTCAGCGCCCCTTAATCATAGACTATCAATCGGCAGGTGTAGACAATAACCACTGGTGTTCCTCTTCTATACACCAACCATTAAAGAAAGGAATGGAGAA...

CDS

Download CDS FASTA

675 bp · LXL04_012437|LXL04_012437|OH1004|CDS

ATGAATGAAGCATCCTCCTCCTCCTCATCCTTACCTCAGCAATTTGAAGAAACAATAGAGGAGAACAAAATAAATTTCTTTAGCAACGACTTGCATATCGAACCAGAATCGTACAACTACTACCAGCAGCCTGATCATAGACCCATTGGTACTGTTCCTCTTCAGCGCCCCTTAATCATAGACTATCAATCGGCAGGTGTAGACAATAACCACTGGTGTTCCTCTTCTATACACCAACCATTAAAGAAAGGAATGGAGAA...

Protein

Download Protein FASTA

224 aa · LXL04_012437|LXL04_012437|OH1004|PROTEIN

MNEASSSSSSLPQQFEETIEENKINFFSNDLHIEPESYNYYQQPDHRPIGTVPLQRPLIIDYQSAGVDNNHWCSSSIHQPLKKGMENPRKRVNDGSHQTNVNKKLKHQERMQEIGCVREKMPMRRSQKLADKITALQKLVSPYGKTDTASVLQEAHISINLLHHKIQGLFQKTETSTNNLGAVQFQNNEAVKTGIHDRGLCLVPTSDPRINSLCFWNHNFMPRN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012437`
TK1151 ID	TkA02G561410
OH-1004 ID	LXL04_012437
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 46.429 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012437

Location Chr03:12227318-12228513 (-)

Description Similar to BHLH154: Transcription factor bHLH154

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20640`	Transcription factor bHLH123.	No verified direct reference in this release
`At3g19500`	Transcription factor bHLH113.	No verified direct reference in this release
`At4g05170`	Transcription factor bHLH114.	No verified direct reference in this release
`At1g27660`	Transcription factor bHLH110.	No verified direct reference in this release
`At2g31730`	Transcription factor bHLH154.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012437 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0005634 nucleus Cellular Component

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G27660

ath:AT2G31730

ath:AT3G19500

ath:AT3G20640

ath:AT4G05170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.978

Rank 1 · LXL04_012437 · OH-1004

Cytoplasm0.088

Rank 2 · LXL04_012437 · OH-1004

Cell membrane0.020

Rank 3 · LXL04_012437 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_012437 · OH-1004

Plastid0.009

Rank 5 · LXL04_012437 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXT3`	Arabidopsis thaliana	Transcription factor bHLH123	36.792%	Swiss-Prot	weak database homology
`Q9LT67`	Arabidopsis thaliana	Transcription factor bHLH113	37.589%	Swiss-Prot	moderate database homology
`Q9M0X8`	Arabidopsis thaliana	Transcription factor bHLH114	40.816%	Swiss-Prot	weak database homology
`Q9SFZ3`	Arabidopsis thaliana	Transcription factor bHLH110	46.067%	Swiss-Prot	weak database homology
`Q7XJU1`	Arabidopsis thaliana	Transcription factor bHLH154	42.857%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card