LXL04_012018 | RubberDandelionOmics

Gene overview

LXL04_012018

Reference: OH-1004 Chr: Chr03 Coordinates: 4881470-4893132 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3888 bp · LXL04_012018|LXL04_012018|OH1004|cDNA

atgaaaaatgaatCGGATTATTTGGAGGGAATTGTCGTGTTTGTTGGGACTATATGGACCGCTGTCACAGCAGTGAACAACAGGATTCTCTCTATTTATGTCACTTCCACAACCTTCATCAGAATTGAAGGAACCTCGAATAATCCCGTTGATGATGGTCATGAAACCTTACATCATAATAATCAAGGATCACATTCATTCGTCAAATTGAGGAAAATACCCCCAATCCCGATTCGTCGGATCCACACCATGTCTGAAAC...

CDS

Download CDS FASTA

3888 bp · LXL04_012018|LXL04_012018|OH1004|CDS

ATGAAAAATGAATCGGATTATTTGGAGGGAATTGTCGTGTTTGTTGGGACTATATGGACCGCTGTCACAGCAGTGAACAACAGGATTCTCTCTATTTATGTCACTTCCACAACCTTCATCAGAATTGAAGGAACCTCGAATAATCCCGTTGATGATGGTCATGAAACCTTACATCATAATAATCAAGGATCACATTCATTCGTCAAATTGAGGAAAATACCCCCAATCCCGATTCGTCGGATCCACACCATGTCTGAAAC...

Protein

Download Protein FASTA

1295 aa · LXL04_012018|LXL04_012018|OH1004|PROTEIN

MKNESDYLEGIVVFVGTIWTAVTAVNNRILSIYVTSTTFIRIEGTSNNPVDDGHETLHHNNQGSHSFVKLRKIPPIPIRRIHTMSETRDNNVGGGCDDDIKGNEDRDRKTSEIDILDASSLGLNRIRSRSSASHRNNDSTAGTASKLGAYDVDKISNPPGAKVDTTQQPPKADPGKKVSWGQSKSLQVQLLSDTGMEGSNSAFAKEMQSPRFQAIMRVTSGRKKKVPDIKSFSHELNSEGVRPFPLWKPRAYGHVEEIMV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012018`
TK1151 ID	TkA02G592450
OH-1004 ID	LXL04_012018
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.853 / OH-1004 83.166 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012018

Location Chr03:4881470-4893132 (+)

Description Similar to IRE: Probable serine/threonine protein kinase IRE

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62310`	Modulates root tip growth.	No verified direct reference in this release
`At3g17850`	May be involved in root hair elongation.	No verified direct reference in this release
`At1g48490`	Probable serine/threonine protein kinase IRE3.	No verified direct reference in this release
`At1g45160`	Probable serine/threonine protein kinase IRE4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012018 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007010 cytoskeleton organization Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

GO:0035618 root hair Cellular Component

GO:0000287 magnesium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G45160

ath:AT1G48490

ath:AT3G17850

ath:AT5G62310

xla:447257

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.510

Rank 1 · LXL04_012018 · OH-1004

Nucleus0.309

Rank 2 · LXL04_012018 · OH-1004

Cell membrane0.167

Rank 3 · LXL04_012018 · OH-1004

Mitochondrion0.081

Rank 4 · LXL04_012018 · OH-1004

Golgi apparatus0.075

Rank 5 · LXL04_012018 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26031.1IREH1247-365 aa

PF00069.32Pkinase778-1070 aa

PF07714.24PK_Tyr_Ser-Thr779-926 aa

PF07714.24PK_Tyr_Ser-Thr974-1055 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012018	`PF26031.1`	IREH1	247	365	1.5e-54	184.1
LXL04_012018	`PF00069.32`	Pkinase	778	1070	4e-62	210.7
LXL04_012018	`PF07714.24`	PK_Tyr_Ser-Thr	779	926	4.5e-30	105.5
LXL04_012018	`PF07714.24`	PK_Tyr_Ser-Thr	974	1055	4.5e-30	105.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LE81`	Arabidopsis thaliana	Probable serine/threonine protein kinase IRE	57.333%	Swiss-Prot	strong database homology
`F4J6F6`	Arabidopsis thaliana	Probable serine/threonine protein kinase IREH1	48.574%	Swiss-Prot	moderate database homology
`F4HYG2`	Arabidopsis thaliana	Probable serine/threonine protein kinase IRE3	48.411%	Swiss-Prot	moderate database homology
`F4HPN2`	Arabidopsis thaliana	Probable serine/threonine protein kinase IRE4	42.826%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card