LXL04_011137 | RubberDandelionOmics

Gene overview

LXL04_011137

Reference: OH-1004 Chr: Chr02 Coordinates: 158682319-158687762 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1248 bp · LXL04_011137|LXL04_011137|OH1004|cDNA

ATGGGTTTGGTTGAGGTTTTACGAACAATAGATTTCGAACATGAATCGTACCCAACTTATGAAGATTTCGCAATTCTTCCTGCGTTTGCTATTTTTTTCCCAATTGTTCGATATGCCCTCGACAGATATGTTTTTGAGAAGTTTCGCAGAGCTAGCTCTGCGGATCCGCAGAGGCCCCTCTGTGGAACTGTTCTTGGCCTCTGCAGAACTGTTCTTCAGAAATCAGATGGTCTCGAAACTATGatttctCAAGAACAGTT...

CDS

Download CDS FASTA

1248 bp · LXL04_011137|LXL04_011137|OH1004|CDS

ATGGGTTTGGTTGAGGTTTTACGAACAATAGATTTCGAACATGAATCGTACCCAACTTATGAAGATTTCGCAATTCTTCCTGCGTTTGCTATTTTTTTCCCAATTGTTCGATATGCCCTCGACAGATATGTTTTTGAGAAGTTTCGCAGAGCTAGCTCTGCGGATCCGCAGAGGCCCCTCTGTGGAACTGTTCTTGGCCTCTGCAGAACTGTTCTTCAGAAATCAGATGGTCTCGAAACTATGATTTCTCAAGAACAGTT...

Protein

Download Protein FASTA

415 aa · LXL04_011137|LXL04_011137|OH1004|PROTEIN

MGLVEVLRTIDFEHESYPTYEDFAILPAFAIFFPIVRYALDRYVFEKFRRASSADPQRPLCGTVLGLCRTVLQKSDGLETMISQEQFRRGQEQFRRASSAKLLTYRGSVQMRNKLSKVAVFYKVFKDKEPSMAAWGAVMRKEGHVTEDSDILQGIGKRLIFPKEHEKLDIETEEKNKKIRKFNESAWKCVYYLSAEILALVVSHNEPWFTNTINFWVGPGDQRWPDQKAKLKLKGLYMYTGGFYVYSIFALIFWETRRSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011137`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011137

Location Chr02:158682319-158687762 (+)

Description Similar to At1g13580: LAG1 longevity assurance homolog 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13580`	Essential for plant growth, promotes cell division in root meristems.	Disruption of the ceramide synthase LOH1 causes spontaneous cell death in Arabidopsis thaliana.2011 · DOI: 10.1111/j.1469-8137.2011.03852.x Unsaturation of very-long-chain ceramides protects plant from hypoxia-induced damages by modulating ethylene signaling in Arabidopsis.2015 · DOI: 10.1371/journal.pgen.1005143 Overexpression of Arabidopsis Ceramide Synthases Differentially Affects Growth, Sphingolipid Metabolism, Programmed Cell Death, and Mycotoxin Resistance.2015 · DOI: 10.1104/pp.15.00987 Substrate specificity, kinetic properties and inhibition by fumonisin B1 of ceramide synthase isoforms from Arabidopsis.2016 · DOI: 10.1042/bj20150824
`At3g25540`	Essential for plant growth, promotes cell division in root meristems.	Disruption of the ceramide synthase LOH1 causes spontaneous cell death in Arabidopsis thaliana.2011 · DOI: 10.1111/j.1469-8137.2011.03852.x Unsaturation of very-long-chain ceramides protects plant from hypoxia-induced damages by modulating ethylene signaling in Arabidopsis.2015 · DOI: 10.1371/journal.pgen.1005143 Overexpression of Arabidopsis Ceramide Synthases Differentially Affects Growth, Sphingolipid Metabolism, Programmed Cell Death, and Mycotoxin Resistance.2015 · DOI: 10.1104/pp.15.00987 Substrate specificity, kinetic properties and inhibition by fumonisin B1 of ceramide synthase isoforms from Arabidopsis.2016 · DOI: 10.1042/bj20150824

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0581300`	Mediates resistance to sphinganine-analog mycotoxins (SAMs) by restoring the sphingolipid biosynthesis.	No verified direct reference in this release
`Os02g0728300`	Mediates resistance to sphinganine-analog mycotoxins (SAMs) by restoring the sphingolipid biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011137 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006665 sphingolipid metabolic process Biological Process

GO:0010256 endomembrane system organization Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0046513 ceramide biosynthetic process Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0050291 sphingosine N-acyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G13580

dosa:Os02g0581300

sly:543781

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.733

Rank 1 · LXL04_011137 · OH-1004

Nucleus0.127

Rank 2 · LXL04_011137 · OH-1004

Cell membrane0.089

Rank 3 · LXL04_011137 · OH-1004

Golgi apparatus0.089

Rank 4 · LXL04_011137 · OH-1004

Cytoplasm0.084

Rank 5 · LXL04_011137 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03798.22TRAM_LAG1_CLN8181-387 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011137	`PF03798.22`	TRAM_LAG1_CLN8	181	387	1.9e-47	162.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NQI8`	Arabidopsis thaliana	Ceramide synthase 1 LOH3	74.627%	Swiss-Prot	moderate database homology
`Q9LDF2`	Arabidopsis thaliana	Ceramide synthase LOH1	72.177%	Swiss-Prot	moderate database homology
`Q6EUN0`	Oryza sativa subsp. japonica	ASC1-like protein 1	69.776%	Swiss-Prot	moderate database homology
`Q6YWS8`	Oryza sativa subsp. japonica	ASC1-like protein 2	64.729%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card