Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1551 bp · LXL04_011058|LXL04_011058|OH1004|cDNA
ATGGAGACGTGGTTTATCATCGTCGTTTCACTCTGCATCGCCGCCCTTATCAGATCCCTCCTCTTCCGCCGGAGTGACGGCAAGAAGCTACCACCAGGGCCGTCGCTCCTCTCCTCCAACTTCATAATTCTAACCAATTCCCTCTCGGGATTAGAACCCATTCTCAGAAATTTCAAGGCCAAGTATGGGCCAATTATCACTCTCTCCATCGGTTCTCGGCCTTCTATCTTCGTCGGAAGCCACTCCCTCGCCCACCAACT...
1551 bp · LXL04_011058|LXL04_011058|OH1004|CDS
ATGGAGACGTGGTTTATCATCGTCGTTTCACTCTGCATCGCCGCCCTTATCAGATCCCTCCTCTTCCGCCGGAGTGACGGCAAGAAGCTACCACCAGGGCCGTCGCTCCTCTCCTCCAACTTCATAATTCTAACCAATTCCCTCTCGGGATTAGAACCCATTCTCAGAAATTTCAAGGCCAAGTATGGGCCAATTATCACTCTCTCCATCGGTTCTCGGCCTTCTATCTTCGTCGGAAGCCACTCCCTCGCCCACCAACT...
Protein
Download Protein FASTA516 aa · LXL04_011058|LXL04_011058|OH1004|PROTEIN
METWFIIVVSLCIAALIRSLLFRRSDGKKLPPGPSLLSSNFIILTNSLSGLEPILRNFKAKYGPIITLSIGSRPSIFVGSHSLAHQLLIQKGAVFSDRPRLTSPVVNISSAAYGATWRVLRRNLASEVLHPSRVKSYSWARNWVLQILIGRLQGQKDAAGIKVIDHFTYAMFCLLVFMCFGEKLDEHRINEIAAVQRRLLLLVASGRFNVLGLFPRLGKILFRNRWNELFQIRHDQEEVLIPRIKSRIEAANTAKQSVGE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_011058 |
|---|---|
| TK1151 ID | TkA03G563250 |
| OH-1004 ID | LXL04_011058 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 80.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 58.333Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_011058 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:157287901-157289451 (+) | |||||||||
| Description | Similar to CYP89A2: Cytochrome P450 89A2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0015996 chlorophyll catabolic process Biological Process GO:0033310 chlorophyll a catabolic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component GO:0003958 NADPH-hemoprotein reductase activity Molecular Function GO:0004497 monooxygenase activity Molecular Function GO:0005506 iron ion binding Molecular Function GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G64900 ath:AT3G03470 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00067.28p45031-499 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_011058 | PF00067.28 | p450 | 31 | 499 | 1.6e-87 | 294.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.