LXL04_011022 | RubberDandelionOmics

Gene overview

LXL04_011022

Reference: OH-1004 Chr: Chr02 Coordinates: 156582261-156585308 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3048 bp · LXL04_011022|LXL04_011022|OH1004|cDNA

ATGTTTACTGGGATGGTTGTTTTATGGAAGATTTGGGTACTTGTGATTCTTCTTGGGGTTTCTCAGGTTCTCGTGATTTCGCAGAACATCACTTGCAATTCGAGTGATTTAGAAGCTTTAGAGGGTTTCAGGAAAAGCTTGGAATCCGCCATTGATGGATGGTGGCCTACAAATTCATCATCGTCGGCCTCTTTCAATTGCTGTAATTGGGTAGGAATTGAGTGTAATTCCGGTAGGGTTGTTAAATTAGAACTCCCGAA...

CDS

Download CDS FASTA

3048 bp · LXL04_011022|LXL04_011022|OH1004|CDS

ATGTTTACTGGGATGGTTGTTTTATGGAAGATTTGGGTACTTGTGATTCTTCTTGGGGTTTCTCAGGTTCTCGTGATTTCGCAGAACATCACTTGCAATTCGAGTGATTTAGAAGCTTTAGAGGGTTTCAGGAAAAGCTTGGAATCCGCCATTGATGGATGGTGGCCTACAAATTCATCATCGTCGGCCTCTTTCAATTGCTGTAATTGGGTAGGAATTGAGTGTAATTCCGGTAGGGTTGTTAAATTAGAACTCCCGAA...

Protein

Download Protein FASTA

1015 aa · LXL04_011022|LXL04_011022|OH1004|PROTEIN

MFTGMVVLWKIWVLVILLGVSQVLVISQNITCNSSDLEALEGFRKSLESAIDGWWPTNSSSSASFNCCNWVGIECNSGRVVKLELPKKRLTGAFSDLISNLDQLKTLNLTGNFLSGPLPISVFHLPHLEVLDLSSNDFNGAFPVGINLPALRELDFSGNHFHGPIPAGICVNSTGVRVIKLAVNSLNGSIPPEFENCKFLEHLCLASNLLSGAIPEFLFHLPRLGALDLQYNMFTSITEIGNSSSHITSLDVASNQLSGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011022`
TK1151 ID	TkA03G561020
OH-1004 ID	LXL04_011022
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.300
Protein coverage (%)	TK1151 100.000 / OH-1004 29.261 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011022

Location Chr02:156582261-156585308 (-)

Description Similar to PSKR: Phytosulfokine receptor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g02220`	Phytosulfokine receptor with both a serine/threonine-protein kinase activity and a guanylate cyclase activity.	Disruption and overexpression of Arabidopsis phytosulfokine receptor gene affects cellular longevity and potential for growth.2006 · DOI: 10.1104/pp.106.081109 The phytosulfokine (PSK) receptor is capable of guanylate cyclase activity and enabling cyclic GMP-dependent signaling in plants.2011 · DOI: 10.1074/jbc.m110.168823 The tyrosine-sulfated peptide receptors PSKR1 and PSY1R modify the immunity of Arabidopsis to biotrophic and necrotrophic pathogens in an antagonistic manner.2013 · DOI: 10.1111/tpj.12050
`At5g53890`	Phytosulfokine receptor with a serine/threonine-protein kinase activity.	No verified direct reference in this release
`At1g72300`	Tyrosine-sulfated glycopeptide receptor with a serine/threonine-protein kinase activity.	Tyrosine-sulfated glycopeptide involved in cellular proliferation and expansion in Arabidopsis.2007 · DOI: 10.1073/pnas.0706403104 The tyrosine-sulfated peptide receptors PSKR1 and PSY1R modify the immunity of Arabidopsis to biotrophic and necrotrophic pathogens in an antagonistic manner.2013 · DOI: 10.1111/tpj.12050 Receptor kinase-mediated control of primary active proton pumping at the plasma membrane.2014 · DOI: 10.1111/tpj.12680

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0114400`	May be involved in brassenosteroid (BR) perception.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011022 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0045087 innate immune response Biological Process

GO:0045851 pH reduction Biological Process

GO:0051707 response to other organism Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G72300

ath:AT2G02220

ath:AT5G53890

dosa:Os10g0114400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.883

Rank 1 · LXL04_011022 · OH-1004

Endoplasmic reticulum0.084

Rank 2 · LXL04_011022 · OH-1004

Cytoplasm0.059

Rank 3 · LXL04_011022 · OH-1004

Nucleus0.039

Rank 4 · LXL04_011022 · OH-1004

Lysosome / Vacuole0.024

Rank 5 · LXL04_011022 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_881-138 aa

PF12799.14LRR_4103-139 aa

PF13855.13LRR_8246-304 aa

PF13855.13LRR_8317-376 aa

PF24758.2LRR_At5g56370322-401 aa

PF13855.13LRR_8418-476 aa

PF13855.13LRR_8531-586 aa

PF13855.13LRR_8555-610 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011022	`PF13855.13`	LRR_8	81	138	5.6e-38	129.2
LXL04_011022	`PF12799.14`	LRR_4	103	139	1.6e-30	105.1
LXL04_011022	`PF13855.13`	LRR_8	246	304	5.6e-38	129.2
LXL04_011022	`PF13855.13`	LRR_8	317	376	5.6e-38	129.2
LXL04_011022	`PF24758.2`	LRR_At5g56370	322	401	2e-08	34.9
LXL04_011022	`PF13855.13`	LRR_8	418	476	5.6e-38	129.2
LXL04_011022	`PF13855.13`	LRR_8	531	586	5.6e-38	129.2
LXL04_011022	`PF13855.13`	LRR_8	555	610	5.6e-38	129.2
LXL04_011022	`PF00069.32`	Pkinase	740	1005	4.7e-43	148.2
LXL04_011022	`PF07714.24`	PK_Tyr_Ser-Thr	740	1006	7.4e-41	140.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVR7`	Arabidopsis thaliana	Phytosulfokine receptor 1	61.866%	Swiss-Prot	strong database homology
`Q9FN37`	Arabidopsis thaliana	Phytosulfokine receptor 2	47.042%	Swiss-Prot	moderate database homology
`Q9C7S5`	Arabidopsis thaliana	Tyrosine-sulfated glycopeptide receptor 1	41.659%	Swiss-Prot	moderate database homology
`Q7G768`	Oryza sativa subsp. japonica	Brassinosteroid LRR receptor kinase BRL2	33.302%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card