LXL04_010971 | RubberDandelionOmics

Gene overview

LXL04_010971

Reference: OH-1004 Chr: Chr02 Coordinates: 155872921-155875439 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1425 bp · LXL04_010971|LXL04_010971|OH1004|cDNA

ATGGCGAGCCGCAGATCTCTGCAACTTGTATTGAACAGAATCAAGAGAAGGGAAAGCGTTCGATGTTTTGGAACTGCTACCGAAGGCATCGCCTCTCCTGCTACGTCTTCTCGTCACCTTATCGATTTAGAACAGGATTATAGCGCCCACAATTATCATCCTGTCCCTGTTGTATTTTCTCATGGAAAAGGGTCAGCAATTTGGGATCCAGAAGGCAAAAAATATCTCGACTTTCTTGCAGCCTACTCTGCAGTTAATCA...

CDS

Download CDS FASTA

1425 bp · LXL04_010971|LXL04_010971|OH1004|CDS

ATGGCGAGCCGCAGATCTCTGCAACTTGTATTGAACAGAATCAAGAGAAGGGAAAGCGTTCGATGTTTTGGAACTGCTACCGAAGGCATCGCCTCTCCTGCTACGTCTTCTCGTCACCTTATCGATTTAGAACAGGATTATAGCGCCCACAATTATCATCCTGTCCCTGTTGTATTTTCTCATGGAAAAGGGTCAGCAATTTGGGATCCAGAAGGCAAAAAATATCTCGACTTTCTTGCAGCCTACTCTGCAGTTAATCA...

Protein

Download Protein FASTA

474 aa · LXL04_010971|LXL04_010971|OH1004|PROTEIN

MASRRSLQLVLNRIKRRESVRCFGTATEGIASPATSSRHLIDLEQDYSAHNYHPVPVVFSHGKGSAIWDPEGKKYLDFLAAYSAVNQGHCHPKIMKALIDQAQTLTLSSRAFYNDKFPIFAEYVTKMFGYDMVLPMNTGAEGVETALKLARKWGYEKKRIPKDQGIIVSCCGCFHGRTMAAISMSCDNDATRGFWPLLPGQLKVDFGDEAALKKLFEEKGEHIAGFLFEPIQGEAGVIIPPDGYLKAVRELCTKHNVLMI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010971`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010971

Location Chr02:155872921-155875439 (-)

Description Similar to DELTA-OAT: Ornithine aminotransferase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46180`	Mediates degradation of arginine for nitrogen recycling.	Ornithine-delta-aminotransferase is essential for arginine catabolism but not for proline biosynthesis.2008 · DOI: 10.1186/1471-2229-8-40

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0643300`	Confers drought and oxidative stress tolerance mainly through enhancing ROS-scavenging capacity and Pro pre-accumulation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010971 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006591 ornithine metabolic process Biological Process

GO:0006593 L-ornithine catabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009413 response to flooding Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009753 response to jasmonic acid Biological Process

KEGG gene cross-reference

ani:ANIA_01810

ath:AT5G46180

ddi:DDB_G0287913

dosa:Os03g0643300

spo:2540626

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.940

Rank 1 · LXL04_010971 · OH-1004

Cytoplasm0.089

Rank 2 · LXL04_010971 · OH-1004

Nucleus0.065

Rank 3 · LXL04_010971 · OH-1004

Cell membrane0.039

Rank 4 · LXL04_010971 · OH-1004

Plastid0.011

Rank 5 · LXL04_010971 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00202.28Aminotran_347-440 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010971	`PF00202.28`	Aminotran_3	47	440	4.3e-123	411.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNK4`	Arabidopsis thaliana	Ornithine aminotransferase, mitochondrial	71.338%	Swiss-Prot	strong database homology
`Q10G56`	Oryza sativa subsp. japonica	Ornithine aminotransferase, mitochondrial	70.413%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card