LXL04_010518 | RubberDandelionOmics

Gene overview

LXL04_010518

Reference: OH-1004 Chr: Chr02 Coordinates: 148198454-148200742 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1803 bp · LXL04_010518|LXL04_010518|OH1004|cDNA

ATGTTGTTATCACGACCACTTTTAATCCTGAAATGGGCCTTCTTGATGATATCAATAACCACAATAGCAGACTCTAGTCCTCCCGAAGAACCAGTCAAATGTTCAACCAATCTCACAAACTGCACCATCACCAACTCCTACGGGACATTTCCCGATCGTACCATCTGCCATGCAGCCGAGGTCGCATACCCATCATCGGAAAAAGACCTTATCTCAGTAATTGCCAATGGTACGCAGTTAAAAAGAAAGATGAGAGTAGC...

CDS

Download CDS FASTA

1803 bp · LXL04_010518|LXL04_010518|OH1004|CDS

ATGTTGTTATCACGACCACTTTTAATCCTGAAATGGGCCTTCTTGATGATATCAATAACCACAATAGCAGACTCTAGTCCTCCCGAAGAACCAGTCAAATGTTCAACCAATCTCACAAACTGCACCATCACCAACTCCTACGGGACATTTCCCGATCGTACCATCTGCCATGCAGCCGAGGTCGCATACCCATCATCGGAAAAAGACCTTATCTCAGTAATTGCCAATGGTACGCAGTTAAAAAGAAAGATGAGAGTAGC...

Protein

Download Protein FASTA

600 aa · LXL04_010518|LXL04_010518|OH1004|PROTEIN

MLLSRPLLILKWAFLMISITTIADSSPPEEPVKCSTNLTNCTITNSYGTFPDRTICHAAEVAYPSSEKDLISVIANGTQLKRKMRVATRYSHSIPKLVCPDGNDGLIISTENLNRIIKIDNESMLITVESGVTLKQLINEAAKSGLVLPYTPYWWGLTIGGMLGTGAHGSTLWGEGSAIHDYVVQMRIVTPSGADEGYAKVRTLEENRESDHGDMNAAKVSLGVLGVISQVTLRMQPLFKRSITLVTQNDTDLSDQVATF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010518`
TK1151 ID	TkA03G532480
OH-1004 ID	LXL04_010518
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.900
Protein coverage (%)	TK1151 97.286 / OH-1004 77.667 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010518

Location Chr02:148198454-148200742 (+)

Description Similar to GULLO6: Probable L-gulonolactone oxidase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46760`	May be involved in the biosynthesis of ascorbic acid.	No verified direct reference in this release
`At2g46750`	Catalyzes the oxidation of L-gulono-1,4-lactone to ascorbic acid.	The contribution of Arabidopsis homologs of L-gulono-1,4-lactone oxidase to the biosynthesis of ascorbic acid.2010 · DOI: 10.1271/bbb.100157
`At2g46740`	Catalyzes the oxidation of L-gulono-1,4-lactone to ascorbic acid.	No verified direct reference in this release
`At1g32300`	May be involved in the biosynthesis of ascorbic acid.	No verified direct reference in this release
`At5g56490`	May be involved in the biosynthesis of ascorbic acid.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010518 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0019853 L-ascorbic acid biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0003885 D-arabinono-1,4-lactone oxidase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0050105 L-gulonolactone oxidase activity Molecular Function

GO:0071949 FAD binding Molecular Function

KEGG gene cross-reference

ath:AT1G32300

ath:AT2G46740

ath:AT2G46750

ath:AT2G46760

ath:AT5G56490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.342

Rank 1 · LXL04_010518 · OH-1004

Cell membrane0.221

Rank 2 · LXL04_010518 · OH-1004

Extracellular0.156

Rank 3 · LXL04_010518 · OH-1004

Endoplasmic reticulum0.141

Rank 4 · LXL04_010518 · OH-1004

Cytoplasm0.122

Rank 5 · LXL04_010518 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01565.29FAD_binding_460-193 aa

PF04030.20ALO394-532 aa

PF22906.2GULLO2-like_3rd544-582 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010518	`PF01565.29`	FAD_binding_4	60	193	1.4e-20	74.2
LXL04_010518	`PF04030.20`	ALO	394	532	5e-17	63.2
LXL04_010518	`PF22906.2`	GULLO2-like_3rd	544	582	6.3e-23	80.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81032`	Arabidopsis thaliana	Probable L-gulonolactone oxidase 6	62.565%	Swiss-Prot	strong database homology
`Q6NQ66`	Arabidopsis thaliana	L-gulonolactone oxidase 2	61.646%	Swiss-Prot	strong database homology
`O81030`	Arabidopsis thaliana	L-gulonolactone oxidase 5	59.655%	Swiss-Prot	strong database homology
`Q9C614`	Arabidopsis thaliana	Probable L-gulonolactone oxidase 1	59.619%	Swiss-Prot	strong database homology
`Q9FM82`	Arabidopsis thaliana	Probable L-gulonolactone oxidase 4	59.896%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card