LXL04_010469 | RubberDandelionOmics

Gene overview

LXL04_010469

Reference: OH-1004 Chr: Chr02 Coordinates: 147198920-147206815 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4110 bp · LXL04_010469|LXL04_010469|OH1004|cDNA

ATGCCGCCGAGGAAGAAAGCCGCCTCCGCCGCCGGAGGGTCGAAGAAATCAAACCAAAATCAACAACAGTCATCTGAAAAACCCTCCAAATTTGGCATTCAACATTTCTTCGAACGCCACACTCAaaactctctctctcaaaaCCCCCAAAAACAGCAGCCCGCCATCGCAAAAGCATCCTCAGTTGATGTCGGTTCGGATCCAGTAAGATTAAACCAACCGGTTGCCAGTACTATCGCTGGCTCTAGTTCCGATTCCGG...

CDS

Download CDS FASTA

4110 bp · LXL04_010469|LXL04_010469|OH1004|CDS

ATGCCGCCGAGGAAGAAAGCCGCCTCCGCCGCCGGAGGGTCGAAGAAATCAAACCAAAATCAACAACAGTCATCTGAAAAACCCTCCAAATTTGGCATTCAACATTTCTTCGAACGCCACACTCAAAACTCTCTCTCTCAAAACCCCCAAAAACAGCAGCCCGCCATCGCAAAAGCATCCTCAGTTGATGTCGGTTCGGATCCAGTAAGATTAAACCAACCGGTTGCCAGTACTATCGCTGGCTCTAGTTCCGATTCCGG...

Protein

Download Protein FASTA

1369 aa · LXL04_010469|LXL04_010469|OH1004|PROTEIN

MPPRKKAASAAGGSKKSNQNQQQSSEKPSKFGIQHFFERHTQNSLSQNPQKQQPAIAKASSVDVGSDPVRLNQPVASTIAGSSSDSGVNPRTELGPGNANKEDNKNPSQSTPVEDLISVGRGDANGNRLEVSPEFCKSLSRKRMKFSPGMLIDQSQDDGGDEVTWRISPVNERLHALTKNLVDARKVLGESSRINIMKFKQSSDNKFSPCSSFKLERVLSSPPMKATESSLKFIKGINLEKRNLEQDLISYGNNEKATDK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010469`
TK1151 ID	TkA03G529260
OH-1004 ID	LXL04_010469
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010469

Location Chr02:147198920-147206815 (-)

Description Similar to JHS1: DNA replication ATP-dependent helicase/nuclease JHS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08840`	Essential protein required during embryogenesis.	A DNA2 Homolog Is Required for DNA Damage Repair, Cell Cycle Regulation, and Meristem Maintenance in Plants.2016 · DOI: 10.1104/pp.16.00312

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010469 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000076 DNA replication checkpoint signaling Biological Process

GO:0000723 telomere maintenance Biological Process

GO:0000729 DNA double-strand break processing Biological Process

GO:0006260 DNA replication Biological Process

GO:0006264 mitochondrial DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006284 base-excision repair Biological Process

GO:0006974 DNA damage response Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0015880 coenzyme A transport Biological Process

GO:0032201 telomere maintenance via semi-conservative replication Biological Process

GO:0033567 DNA replication, Okazaki fragment processing Biological Process

KEGG gene cross-reference

ath:AT1G08840

gga:423688

mmu:327762

xla:378492

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.849

Rank 1 · LXL04_010469 · OH-1004

Cytoplasm0.170

Rank 2 · LXL04_010469 · OH-1004

Mitochondrion0.059

Rank 3 · LXL04_010469 · OH-1004

Cell membrane0.023

Rank 4 · LXL04_010469 · OH-1004

Endoplasmic reticulum0.011

Rank 5 · LXL04_010469 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08696.18Dna2387-589 aa

PF12705.14PDDEXK_1445-706 aa

PF13604.13AAA_30944-1108 aa

PF13086.13AAA_11945-1034 aa

PF00580.28UvrD-helicase945-1010 aa

PF13245.13AAA_19949-1108 aa

PF13086.13AAA_111045-1112 aa

PF13087.13AAA_121121-1320 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010469	`PF08696.18`	Dna2	387	589	9e-60	202.6
LXL04_010469	`PF12705.14`	PDDEXK_1	445	706	3.4e-06	27.9
LXL04_010469	`PF13604.13`	AAA_30	944	1108	1.2e-09	38.9
LXL04_010469	`PF13086.13`	AAA_11	945	1034	4.8e-35	122.3
LXL04_010469	`PF00580.28`	UvrD-helicase	945	1010	9.2e-06	26.2
LXL04_010469	`PF13245.13`	AAA_19	949	1108	3.3e-08	34.5
LXL04_010469	`PF13086.13`	AAA_11	1045	1112	4.8e-35	122.3
LXL04_010469	`PF13087.13`	AAA_12	1121	1320	5.5e-51	173.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A1P8ASY1`	Arabidopsis thaliana	DNA replication ATP-dependent helicase/nuclease JHS1	54.453%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card