LXL04_010410 | RubberDandelionOmics

Gene overview

LXL04_010410

Reference: OH-1004 Chr: Chr02 Coordinates: 146200115-146203531 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1326 bp · LXL04_010410|LXL04_010410|OH1004|cDNA

ATGGTTCGTTCCAACGGCATTAAACTGTTCTCATGGATTGCTCGCCGGTCCCTCTCAAACGATCCCTCGTATGAGTCGCTTGCAAGAGGAGGTTATCGGAAGTTTGGCTCATCAATTCACGGTCATTACAAGATTTCAACCTGCCGCAGTTACAAAAATGGAGTCAATTCGAGATATTGGTCAAATCTTGGAACGATTAAATCACATTATGGCAACAATAGATCGATTCATGGCACTTCACACATGGCTGCAAAGGATTA...

CDS

Download CDS FASTA

1326 bp · LXL04_010410|LXL04_010410|OH1004|CDS

ATGGTTCGTTCCAACGGCATTAAACTGTTCTCATGGATTGCTCGCCGGTCCCTCTCAAACGATCCCTCGTATGAGTCGCTTGCAAGAGGAGGTTATCGGAAGTTTGGCTCATCAATTCACGGTCATTACAAGATTTCAACCTGCCGCAGTTACAAAAATGGAGTCAATTCGAGATATTGGTCAAATCTTGGAACGATTAAATCACATTATGGCAACAATAGATCGATTCATGGCACTTCACACATGGCTGCAAAGGATTA...

Protein

Download Protein FASTA

441 aa · LXL04_010410|LXL04_010410|OH1004|PROTEIN

MVRSNGIKLFSWIARRSLSNDPSYESLARGGYRKFGSSIHGHYKISTCRSYKNGVNSRYWSNLGTIKSHYGNNRSIHGTSHMAAKDYYDTLGVNKNATASEIKKAYYGLAKKWHPDANKDDPEAETKFQEVSKAYEVLKDEEKRAQYDQLGHETFEASASGGGGGPDAGHWRNPFQDLGDIFGFGPFARNFTGKDVKVALELSFMEAVQGCTKSVVFQTELPCETCGGSGVPPGTKPETCRRCKGAGMTFSQTGPFRIQV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010410`
TK1151 ID	TkA03G526040
OH-1004 ID	LXL04_010410
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.300
Protein coverage (%)	TK1151 95.687 / OH-1004 80.272 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010410

Location Chr02:146200115-146203531 (-)

Description Similar to GFA2: Chaperone protein dnaJ GFA2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48030`	Chaperone that may play a role in mitochondrial protein folding.	Mitochondrial GFA2 is required for synergid cell death in Arabidopsis.2002 · DOI: 10.1105/tpc.002170

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010410 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000740 nuclear membrane fusion Biological Process

GO:0006260 DNA replication Biological Process

GO:0006457 protein folding Biological Process

GO:0009408 response to heat Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009558 embryo sac cellularization Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0010198 synergid death Biological Process

GO:0042026 protein refolding Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G48030

nma:NMA0209

nmc:NMC0043

nme:NMB0059

nmn:NMCC_0067

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.895

Rank 1 · LXL04_010410 · OH-1004

Plastid0.087

Rank 2 · LXL04_010410 · OH-1004

Cytoplasm0.078

Rank 3 · LXL04_010410 · OH-1004

Nucleus0.045

Rank 4 · LXL04_010410 · OH-1004

Cell membrane0.028

Rank 5 · LXL04_010410 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226.37DnaJ86-148 aa

PF01556.24DnaJ_C197-409 aa

PF00684.26DnaJ_CXXCXGXG223-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010410	`PF00226.37`	DnaJ	86	148	7.7e-28	97.1
LXL04_010410	`PF01556.24`	DnaJ_C	197	409	6.6e-44	150.3
LXL04_010410	`PF00684.26`	DnaJ_CXXCXGXG	223	282	1.4e-12	48.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWW8`	Arabidopsis thaliana	Chaperone protein dnaJ GFA2, mitochondrial	59.081%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card