LXL04_010311 | RubberDandelionOmics

Gene overview

LXL04_010311

Reference: OH-1004 Chr: Chr02 Coordinates: 144026394-144029211 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1816 bp · LXL04_010311|LXL04_010311|OH1004|cDNA

ACAAAGATCTTTCTGTTTGTTATCACACAATTTGCAATCAGTATCTAAATTAATCCCAAAAATGGAAGCTGATTATGAAGTTGGCGCGAAGGCGGAGCCGACAACCACCATGCCGTCATCCACCGGAACCCTCGGGGCACATCTGGCTCGCCGTTTAGTTCAGATTGGTGTGAAAGACGTGTTCTCTGTTCCCGGCGACTTTAACTTGACCTTACTTGACTACTTGGTCGCGGAGCCGGGTCTCAACCTCGTTGGCTGCT...

CDS

Download CDS FASTA

1800 bp · LXL04_010311|LXL04_010311|OH1004|CDS

TTGTTATCACACAATTTGCAATCAGTATCTAAATTAATCCCAAAAATGGAAGCTGATTATGAAGTTGGCGCGAAGGCGGAGCCGACAACCACCATGCCGTCATCCACCGGAACCCTCGGGGCACATCTGGCTCGCCGTTTAGTTCAGATTGGTGTGAAAGACGTGTTCTCTGTTCCCGGCGACTTTAACTTGACCTTACTTGACTACTTGGTCGCGGAGCCGGGTCTCAACCTCGTTGGCTGCTGCAACGAGCTAAACGC...

Protein

Download Protein FASTA

599 aa · LXL04_010311|LXL04_010311|OH1004|PROTEIN

MLSHNLQSVSKLIPKMEADYEVGAKAEPTTTMPSSTGTLGAHLARRLVQIGVKDVFSVPGDFNLTLLDYLVAEPGLNLVGCCNELNAGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGACSESLPVICIVGGPNSNDYGTNRILHHTIGVPDFTQESQCFQTVTCAQAVVNNLEDAHEQIDTAITTALKESKPVYISISCNLPGIPHPTFTKEPVPFFLPPFSSNPLGLEAAVEETAKFLNKAVKPVIVAGCKLRVAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010311`
TK1151 ID	TkA03G518510
OH-1004 ID	LXL04_010311
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.600
Protein coverage (%)	TK1151 99.153 / OH-1004 58.598 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010311

Location Chr02:144026394-144029211 (+)

Description Similar to PDC1: Pyruvate decarboxylase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XFI3`	Pyruvate decarboxylase 2.	No verified direct reference in this release
`Os03g0293500`	Pyruvate decarboxylase 2.	No verified direct reference in this release
`UniProt: A2Y5L9`	Pyruvate decarboxylase 1.	No verified direct reference in this release
`Os05g0469600`	Pyruvate decarboxylase 1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010311 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000949 aromatic amino acid family catabolic process to alcohol via Ehrlich pathway Biological Process

GO:0006950 response to stress Biological Process

GO:0036293 response to decreased oxygen levels Biological Process

GO:0005829 cytosol Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004737 pyruvate decarboxylase activity Molecular Function

GO:0030976 thiamine pyrophosphate binding Molecular Function

KEGG gene cross-reference

dosa:Os03g0293500

dosa:Os05g0469600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.753

Rank 1 · LXL04_010311 · OH-1004

Nucleus0.319

Rank 2 · LXL04_010311 · OH-1004

Mitochondrion0.065

Rank 3 · LXL04_010311 · OH-1004

Cell membrane0.055

Rank 4 · LXL04_010311 · OH-1004

Endoplasmic reticulum0.055

Rank 5 · LXL04_010311 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02776.24TPP_enzyme_N38-143 aa

PF00205.29TPP_enzyme_M235-352 aa

PF02775.27TPP_enzyme_C445-570 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010311	`PF02776.24`	TPP_enzyme_N	38	143	2.3e-29	102.3
LXL04_010311	`PF00205.29`	TPP_enzyme_M	235	352	1.7e-24	86.8
LXL04_010311	`PF02775.27`	TPP_enzyme_C	445	570	7.1e-17	62.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2XFI3`	Oryza sativa subsp. indica	Pyruvate decarboxylase 2	79.310%	Swiss-Prot	strong database homology
`Q10MW3`	Oryza sativa subsp. japonica	Pyruvate decarboxylase 2	79.310%	Swiss-Prot	strong database homology
`A2Y5L9`	Oryza sativa subsp. indica	Pyruvate decarboxylase 1	78.445%	Swiss-Prot	strong database homology
`Q0DHF6`	Oryza sativa subsp. japonica	Pyruvate decarboxylase 1	78.269%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card