LXL04_010258 | RubberDandelionOmics

Gene overview

LXL04_010258

Reference: OH-1004 Chr: Chr02 Coordinates: 143346792-143361843 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

687 bp · LXL04_010258|LXL04_010258|OH1004|cDNA

ATGGATAACCAAAAAGAAATCTTTTCGAGTGAGGAGCATGTCGCAAAAGCTAAACCTCAGAAAAACAAATCTCCACAAAAACTCACCAAAGTGGACAAGAAAAAGGCAATCCATGAGAATCAGAAGTTGAAAAATGATGTTGACCTTGATGACAATGACTTGCTTAATAAAATAATCGGTTCCGATGGAAAGAGCACGGATGAGGACGACTCTCAAGACAACTCTGAGTACATATCCGTAGATGTCGATCTCCTTCACGA...

CDS

Download CDS FASTA

687 bp · LXL04_010258|LXL04_010258|OH1004|CDS

ATGGATAACCAAAAAGAAATCTTTTCGAGTGAGGAGCATGTCGCAAAAGCTAAACCTCAGAAAAACAAATCTCCACAAAAACTCACCAAAGTGGACAAGAAAAAGGCAATCCATGAGAATCAGAAGTTGAAAAATGATGTTGACCTTGATGACAATGACTTGCTTAATAAAATAATCGGTTCCGATGGAAAGAGCACGGATGAGGACGACTCTCAAGACAACTCTGAGTACATATCCGTAGATGTCGATCTCCTTCACGA...

Protein

Download Protein FASTA

228 aa · LXL04_010258|LXL04_010258|OH1004|PROTEIN

MDNQKEIFSSEEHVAKAKPQKNKSPQKLTKVDKKKAIHENQKLKNDVDLDDNDLLNKIIGSDGKSTDEDDSQDNSEYISVDVDLLHELLDCPLCKEIAKKVKAIKYCLHRFCGECIDKWLENGNTECPTCKTDFVSQKALVRDHNRDKLVAVCFPDREEHEAQDEDTQLMSDKSLESLDKKPEDGDTSTPFVPSEEMLDRVSKQVADRISKYKRKHQQLPAIDEKKES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010258`
TK1151 ID	TkA03G515840
OH-1004 ID	LXL04_010258
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_010258`
Location	Chr02:143346792-143361843 (+)
Description	Similar to Ring1: E3 ubiquitin-protein ligase RING1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010258` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006325 chromatin organization Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0009948 anterior/posterior axis specification Biological Process GO:0009952 anterior/posterior pattern specification Biological Process GO:0010467 gene expression Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031507 heterochromatin formation Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0051321 meiotic cell cycle Biological Process
KEGG gene cross-reference	cfa:607905 dme:Dmel_CG5595 hsa:6015 mmu:19763 rno:309626 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.878

Rank 1 · LXL04_010258 · OH-1004

Cytoplasm0.218

Rank 2 · LXL04_010258 · OH-1004

Mitochondrion0.030

Rank 3 · LXL04_010258 · OH-1004

Cell membrane0.023

Rank 4 · LXL04_010258 · OH-1004

Endoplasmic reticulum0.011

Rank 5 · LXL04_010258 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_290-131 aa

PF00097.32zf-C3HC491-130 aa

PF13923.13zf-C3HC4_291-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010258	`PF13639.13`	zf-RING_2	90	131	6.4e-09	36.6
LXL04_010258	`PF00097.32`	zf-C3HC4	91	130	4.1e-11	43.3
LXL04_010258	`PF13923.13`	zf-C3HC4_2	91	130	1.1e-10	41.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card