LXL04_009911 | RubberDandelionOmics

Gene overview

LXL04_009911

Reference: OH-1004 Chr: Chr02 Coordinates: 135823710-135829763 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1806 bp · LXL04_009911|LXL04_009911|OH1004|cDNA

ATGGGCAAATCAAGGAAGAAACCCGATTCCGAAGCTGATTCGGATCCTGCGGTTGTAGCTTCACCCGCCGCTCTAATAGCAAATGAGACACAAGTTCTTGGTAGCAAGAAGCAGAAGACTGAAAATGGCGACAAGGATCTTGAGAAAAATAATTTTGGAAAGGAGACAGAGGAAAATACTAAGGAAGAGCAAAACAAATCCTCACAAGAGAACAAGGTTGAGGTGTCTCCGGTTATAAAACCTGCAGAAACTACACAAGA...

CDS

Download CDS FASTA

1806 bp · LXL04_009911|LXL04_009911|OH1004|CDS

ATGGGCAAATCAAGGAAGAAACCCGATTCCGAAGCTGATTCGGATCCTGCGGTTGTAGCTTCACCCGCCGCTCTAATAGCAAATGAGACACAAGTTCTTGGTAGCAAGAAGCAGAAGACTGAAAATGGCGACAAGGATCTTGAGAAAAATAATTTTGGAAAGGAGACAGAGGAAAATACTAAGGAAGAGCAAAACAAATCCTCACAAGAGAACAAGGTTGAGGTGTCTCCGGTTATAAAACCTGCAGAAACTACACAAGA...

Protein

Download Protein FASTA

601 aa · LXL04_009911|LXL04_009911|OH1004|PROTEIN

MGKSRKKPDSEADSDPAVVASPAALIANETQVLGSKKQKTENGDKDLEKNNFGKETEENTKEEQNKSSQENKVEVSPVIKPAETTQDANEAKITNEHEEKKGEDKSKEDYQHLDTPIETVEVLPAVTTQDTNTKRARISNDYEEEDEDDKSKEDNHHLETPMESVDVPSDIKSTTQDAKRARISNNEEQDRDDDSKKSGTDVEMLDDSSLKKTDQTELSSQFPGSKTVLMDNLSFLIKEEDVRKFFKNVGEIAEIHFEMK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009911`
TK1151 ID	TkA03G482030
OH-1004 ID	LXL04_009911
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009911

Location Chr02:135823710-135829763 (-)

Description Similar to Os04g0620700: Nucleolin 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18610`	Involved in pre-rRNA processing and ribosome assembly.	No verified direct reference in this release
`At1g48920`	Involved in pre-rRNA processing and ribosome assembly.	Arabidopsis nucleolin affects plant development and patterning.2007 · DOI: 10.1104/pp.106.093575

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0620700`	Involved in pre-rRNA processing and ribosome assembly.	No verified direct reference in this release
`Os08g0192900`	Involved in pre-rRNA processing and ribosome assembly.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009911 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0048364 root development Biological Process

GO:0048366 leaf development Biological Process

GO:0048367 shoot system development Biological Process

GO:0080056 petal vascular tissue pattern formation Biological Process

GO:0080057 sepal vascular tissue pattern formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G48920

ath:AT3G18610

dosa:Os04g0620700

dosa:Os08g0192900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.740

Rank 1 · LXL04_009911 · OH-1004

Cytoplasm0.326

Rank 2 · LXL04_009911 · OH-1004

Cell membrane0.046

Rank 3 · LXL04_009911 · OH-1004

Endoplasmic reticulum0.032

Rank 4 · LXL04_009911 · OH-1004

Mitochondrion0.022

Rank 5 · LXL04_009911 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076.29RRM_1229-293 aa

PF00076.29RRM_1319-385 aa

PF00076.29RRM_1433-489 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009911	`PF00076.29`	RRM_1	229	293	6.4e-36	122.8
LXL04_009911	`PF00076.29`	RRM_1	319	385	6.4e-36	122.8
LXL04_009911	`PF00076.29`	RRM_1	433	489	6.4e-36	122.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PEP5`	Arabidopsis thaliana	Nucleolin 2	41.045%	Swiss-Prot	weak database homology
`Q9FVQ1`	Arabidopsis thaliana	Nucleolin 1	38.967%	Swiss-Prot	weak database homology
`Q7XTT4`	Oryza sativa subsp. japonica	Nucleolin 2	45.045%	Swiss-Prot	weak database homology
`Q6Z1C0`	Oryza sativa subsp. japonica	Nucleolin 1	44.393%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card