LXL04_009632 | RubberDandelionOmics

Gene overview

LXL04_009632

Reference: OH-1004 Chr: Chr02 Coordinates: 130007491-130008252 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

726 bp · LXL04_009632|LXL04_009632|OH1004|cDNA

ATGGGTGGCGTAAGGAGCACAATCTTCCTGTTCATATTCCTGAAACTTTCAATCACAATCGCTTCAAATGATTCATTCTGGCTACTCAAAATCCAATCGGAATTCGTCGATTCAACGGGAGTTTTCAAAAACTCGTCGCCGGGATCAAATATATGCACATGGAACGGCGTACAATGTTCAGAAGATGATCAAACACGTGTCGTGggtataaacctttcaaatTCGGGACTCTCGGGAACGATTTCTCCCGATTTTTCAAA...

CDS

Download CDS FASTA

726 bp · LXL04_009632|LXL04_009632|OH1004|CDS

ATGGGTGGCGTAAGGAGCACAATCTTCCTGTTCATATTCCTGAAACTTTCAATCACAATCGCTTCAAATGATTCATTCTGGCTACTCAAAATCCAATCGGAATTCGTCGATTCAACGGGAGTTTTCAAAAACTCGTCGCCGGGATCAAATATATGCACATGGAACGGCGTACAATGTTCAGAAGATGATCAAACACGTGTCGTGGGTATAAACCTTTCAAATTCGGGACTCTCGGGAACGATTTCTCCCGATTTTTCAAA...

Protein

Download Protein FASTA

241 aa · LXL04_009632|LXL04_009632|OH1004|PROTEIN

MGGVRSTIFLFIFLKLSITIASNDSFWLLKIQSEFVDSTGVFKNSSPGSNICTWNGVQCSEDDQTRVVGINLSNSGLSGTISPDFSKLVSLQKLDLSVNSLTGEIPKKLGELQELQELYLFSNYLTGSMPVEFRLLKKLRVLRIGDNLLTGEIIESIGELSELRYSFKNWEIEVVEVTSVTDDLGVENEINLGGCCELDFKQDPETVAIEDAVKVLLEGLGEDINREGMQIHMLCMRSTCD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009632`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009632

Location Chr02:130007491-130008252 (-)

Description Similar to GSO1: LRR receptor-like serine/threonine-protein kinase GSO1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
`At3g51740`	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2.	No verified direct reference in this release
`At5g21090`	Involved in plant defense response.	A novel simple extracellular leucine-rich repeat (eLRR) domain protein from rice (OsLRR1) enters the endosomal pathway and interacts with the hypersensitive-induced reaction protein 1 (OsHIR1).2009 · DOI: 10.1111/j.1365-3040.2009.02039.x
`At2g26330`	May act as a receptor kinase with ERL1 and ERL2 to regulate shoot architecture and stomatal patterning.	KNAT1 and ERECTA regulate inflorescence architecture in Arabidopsis.2002 · DOI: 10.1105/tpc.010391 Novel as1 and as2 defects in leaf adaxial-abaxial polarity reveal the requirement for ASYMMETRIC LEAVES1 and 2 and ERECTA functions in specifying leaf adaxial identity.2003 · DOI: 10.1242/dev.00622 ERECTA, an LRR receptor-like kinase protein controlling development pleiotropically affects resistance to bacterial wilt.2003 · DOI: 10.1046/j.1365-313x.2003.01877.x Synergistic interaction of three ERECTA-family receptor-like kinases controls Arabidopsis organ growth and flower development by promoting cell proliferation.2004 · DOI: 10.1242/dev.01028 ERECTA is required for protection against heat-stress in the AS1/ AS2 pathway to regulate adaxial-abaxial leaf polarity in Arabidopsis.2004 · DOI: 10.1007/s00425-004-1248-z ERECTA receptor-like kinase and heterotrimeric G protein from Arabidopsis are required for resistance to the necrotrophic fungus Plectosphaerella cucumerina.2005 · DOI: 10.1111/j.1365-313x.2005.02440.x The ERECTA gene regulates plant transpiration efficiency in Arabidopsis.2005 · DOI: 10.1038/nature03835 Pedicel development in Arabidopsis thaliana: contribution of vascular positioning and the role of the BREVIPEDICELLUS and ERECTA genes.2005 · DOI: 10.1016/j.ydbio.2005.06.011 Interaction of auxin and ERECTA in elaborating Arabidopsis inflorescence architecture revealed by the activation tagging of a new member of the YUCCA family putative flavin monooxygenases.2005 · DOI: 10.1104/pp.105.063495 ABA is an essential signal for plant resistance to pathogens affecting JA biosynthesis and the activation of defenses in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048041 Haploinsufficiency after successive loss of signaling reveals a role for ERECTA-family genes in Arabidopsis ovule development.2007 · DOI: 10.1242/dev.004788 Genetics of microenvironmental canalization in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0701936104 A strong effect of growth medium and organ type on the identification of QTLs for phytate and mineral concentrations in three Arabidopsis thaliana RIL populations.2009 · DOI: 10.1093/jxb/erp084 Polymorphic genes of major effect: consequences for variation, selection and evolution in Arabidopsis thaliana.2009 · DOI: 10.1534/genetics.108.097030 The ERECTA Receptor-Like Kinase Regulates Cell Wall-Mediated Resistance to Pathogens in Arabidopsis thaliana.2009 · DOI: 10.1094/mpmi-22-8-0953 Direct interaction of ligand-receptor pairs specifying stomatal patterning.2012 · DOI: 10.1101/gad.179895.111 Regulation of inflorescence architecture by intertissue layer ligand-receptor communication between endodermis and phloem.2012 · DOI: 10.1073/pnas.1117537109 Regulation of plant vascular stem cells by endodermis-derived EPFL-family peptide hormones and phloem-expressed ERECTA-family receptor kinases.2013 · DOI: 10.1093/jxb/ert196 A receptor-like protein acts as a specificity switch for the regulation of stomatal development.2017 · DOI: 10.1101/gad.297580.117 The Arabidopsis ERECTA gene encodes a putative receptor protein kinase with extracellular leucine-rich repeats.1996 · DOI: 10.1105/tpc.8.4.735

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BB68`	LRR receptor kinase involved in defense response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009632 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0045184 establishment of protein localization Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0090708 specification of plant organ axis polarity Biological Process

GO:0160073 Casparian strip assembly Biological Process

GO:2000067 regulation of root morphogenesis Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0048226 Casparian strip Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G20140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.269

Rank 1 · LXL04_009632 · OH-1004

Endoplasmic reticulum0.198

Rank 2 · LXL04_009632 · OH-1004

Plastid0.144

Rank 3 · LXL04_009632 · OH-1004

Cytoplasm0.139

Rank 4 · LXL04_009632 · OH-1004

Nucleus0.136

Rank 5 · LXL04_009632 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_870-125 aa

PF23598.2LRR_1484-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009632	`PF13855.13`	LRR_8	70	125	2e-09	37.8
LXL04_009632	`PF23598.2`	LRR_14	84	165	1.1e-06	28.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGQ5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO1	46.957%	Swiss-Prot	weak database homology
`Q9SCT4`	Arabidopsis thaliana	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2	41.007%	Swiss-Prot	moderate database homology
`Q9FPJ5`	Arabidopsis thaliana	Leucine-rich repeat protein 1	38.406%	Swiss-Prot	moderate database homology
`Q42371`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase ERECTA	36.905%	Swiss-Prot	moderate database homology
`B8BB68`	Oryza sativa subsp. indica	LRR receptor kinase BAK1	33.136%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card