LXL04_009515 | RubberDandelionOmics

Gene overview

LXL04_009515

Reference: OH-1004 Chr: Chr02 Coordinates: 127946697-127950155 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3267 bp · LXL04_009515|LXL04_009515|OH1004|cDNA

ATGCCTGTCTTTCAACCTCTTTTACTCCTAATCTTCTTGATTTTAGTACCTTCTTGTTTTTCACTCAATTCACAAGGTCAAGCTCTTCTTTCATGGAAGAAAACCTTAAAAGGCCAAAATTTGCAGGCCTTAGATAACTGGGACTCGGCCAATGAAACCCCTTGTGGGTGGTTTGGTATCACTTGTGATAGTAACAGAAATGTTGTTGAATTGAGTTTGAGTTATGTGGACTTACTTGGAGCTATTCCTTCTGATTTCAC...

CDS

Download CDS FASTA

3267 bp · LXL04_009515|LXL04_009515|OH1004|CDS

ATGCCTGTCTTTCAACCTCTTTTACTCCTAATCTTCTTGATTTTAGTACCTTCTTGTTTTTCACTCAATTCACAAGGTCAAGCTCTTCTTTCATGGAAGAAAACCTTAAAAGGCCAAAATTTGCAGGCCTTAGATAACTGGGACTCGGCCAATGAAACCCCTTGTGGGTGGTTTGGTATCACTTGTGATAGTAACAGAAATGTTGTTGAATTGAGTTTGAGTTATGTGGACTTACTTGGAGCTATTCCTTCTGATTTCAC...

Protein

Download Protein FASTA

1088 aa · LXL04_009515|LXL04_009515|OH1004|PROTEIN

MPVFQPLLLLIFLILVPSCFSLNSQGQALLSWKKTLKGQNLQALDNWDSANETPCGWFGITCDSNRNVVELSLSYVDLLGAIPSDFTSLLTLKRLVLSGTNLTGSIPKAIGSLQELSYLDLSDNGLTGEIPNELCDLEKLVELYINTNRIEGSIPVEIGKLKNLVVLTCYDNQLGGSIPKSIGELKNLQVIRAGGNKNIEGPLPEEIGNCSGLVMLGIAETSLSGFLPSTIGNLKKLQTLAVYTTLLSGQIPVELGDCTE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009515`
TK1151 ID	TkA03G443920
OH-1004 ID	LXL04_009515
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009515

Location Chr02:127946697-127950155 (+)

Description Similar to RGI3: LRR receptor-like serine/threonine-protein kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56040`	Receptor with a serine/threonine-protein kinase activity (By similarity).	A novel pollen-pistil interaction conferring high-temperature tolerance during reproduction via CLE45 signaling.2013 · DOI: 10.1016/j.cub.2013.06.060 RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63 Arabidopsis MAKR5 is a positive effector of BAM3-dependent CLE45 signaling.2016 · DOI: 10.15252/embr.201642450
`At4g26540`	May act as an RGF peptide receptor regulating root meristem growth.	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At3g24240`	Together with RGI2, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At5g48940`	Together with RGI1, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At1g34110`	Together with RGI1, RGI2, RGI3 and RGI4, acts as a receptor of RGF1, a peptide hormone that maintains the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009515 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009266 response to temperature stimulus Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0010074 maintenance of meristem identity Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010449 root meristem growth Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0001653 peptide receptor activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G34110

ath:AT3G24240

ath:AT4G26540

ath:AT5G48940

ath:AT5G56040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.852

Rank 1 · LXL04_009515 · OH-1004

Endoplasmic reticulum0.088

Rank 2 · LXL04_009515 · OH-1004

Cytoplasm0.065

Rank 3 · LXL04_009515 · OH-1004

Nucleus0.043

Rank 4 · LXL04_009515 · OH-1004

Lysosome / Vacuole0.030

Rank 5 · LXL04_009515 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_222-63 aa

PF13855.13LRR_866-126 aa

PF23598.2LRR_1485-192 aa

PF13855.13LRR_891-150 aa

PF12799.14LRR_4115-151 aa

PF23598.2LRR_14177-265 aa

PF23598.2LRR_14202-289 aa

PF23598.2LRR_14273-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009515	`PF08263.18`	LRRNT_2	22	63	4.8e-10	40.3
LXL04_009515	`PF13855.13`	LRR_8	66	126	4.8e-45	151.9
LXL04_009515	`PF23598.2`	LRR_14	85	192	7.8e-46	157.1
LXL04_009515	`PF13855.13`	LRR_8	91	150	4.8e-45	151.9
LXL04_009515	`PF12799.14`	LRR_4	115	151	1.8e-39	133.6
LXL04_009515	`PF23598.2`	LRR_14	177	265	7.8e-46	157.1
LXL04_009515	`PF23598.2`	LRR_14	202	289	7.8e-46	157.1
LXL04_009515	`PF23598.2`	LRR_14	273	363	7.8e-46	157.1
LXL04_009515	`PF13855.13`	LRR_8	309	367	4.8e-45	151.9
LXL04_009515	`PF12799.14`	LRR_4	331	368	1.8e-39	133.6
LXL04_009515	`PF23598.2`	LRR_14	350	451	7.8e-46	157.1
LXL04_009515	`PF13855.13`	LRR_8	380	439	4.8e-45	151.9
LXL04_009515	`PF23598.2`	LRR_14	461	554	7.8e-46	157.1
LXL04_009515	`PF13855.13`	LRR_8	475	535	4.8e-45	151.9
LXL04_009515	`PF12799.14`	LRR_4	476	512	1.8e-39	133.6
LXL04_009515	`PF23598.2`	LRR_14	566	651	7.8e-46	157.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K6B8`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase RGI4	54.059%	Swiss-Prot	strong database homology
`C0LGR3`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI3	56.453%	Swiss-Prot	strong database homology
`Q9LHP4`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI1	47.131%	Swiss-Prot	moderate database homology
`C0LGV1`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI2	46.816%	Swiss-Prot	moderate database homology
`C0LGF5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI5	45.140%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card