LXL04_009140 | RubberDandelionOmics

Gene overview

LXL04_009140

Reference: OH-1004 Chr: Chr02 Coordinates: 118535917-118538147 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1017 bp · LXL04_009140|LXL04_009140|OH1004|cDNA

ATGCAACTCGATGTTTTAAAATCAGCAACCAACGGGTTTGCAGATGGTAATAAGATCGGGGCTGGAGGATTTGGAGAAGTCTACAAGGGAGAACTCGTTTCAAGCGATCATACGGTGACAGTGGCTGTAAAACGTTTAAATCGTATACATGGCCAAGGAGACTCTGAGTTTTTTAAGGAGGTCATTATGCTTTCATCTTACAAGCATGAAAATATTATCTCCCTCCTTGGGTATTGTGATGAGGAAGACGAGAAGATACT...

CDS

Download CDS FASTA

1002 bp · LXL04_009140|LXL04_009140|OH1004|CDS

ATGCAACTCGATGTTTTAAAATCAGCAACCAACGGGTTTGCAGATGGTAATAAGATCGGGGCTGGAGGATTTGGAGAAGTCTACAAGGGAGAACTCGTTTCAAGCGATCATACGGTGACAGTGGCTGTAAAACGTTTAAATCGTATACATGGCCAAGGAGACTCTGAGTTTTTTAAGGAGGTCATTATGCTTTCATCTTACAAGCATGAAAATATTATCTCCCTCCTTGGGTATTGTGATGAGGAAGACGAGAAGATACT...

Protein

Download Protein FASTA

333 aa · LXL04_009140|LXL04_009140|OH1004|PROTEIN

MQLDVLKSATNGFADGNKIGAGGFGEVYKGELVSSDHTVTVAVKRLNRIHGQGDSEFFKEVIMLSSYKHENIISLLGYCDEEDEKILVYEYASKKSLDKHLGNNELTWIADFGLAKIGPANQQNSIIITNNNNVAGTIGYVDPQYMETGMLTKESDVYSFGVVLFEVLCGRLCISDMVGRSKYLTTWVRYHHKQNRLDEIVWSNTKDEIHPSSLRSFSTIAYQCLEREYDKRPSMKKIVQELETSLEFQGVPTVAGGGGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009140`
TK1151 ID	TkA03G400990
OH-1004 ID	LXL04_009140
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.200
Protein coverage (%)	TK1151 92.481 / OH-1004 97.297 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009140

Location Chr02:118535917-118538147 (+)

Description Similar to HERK1: Receptor-like protein kinase HERK 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At1g30570`	Probable receptor-like protein kinase At1g30570.	No verified direct reference in this release
`At5g54380`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	A receptor-like kinase mediates the response of Arabidopsis cells to the inhibition of cellulose synthesis.2007 · DOI: 10.1016/j.cub.2007.05.018 Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009140 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0043680 filiform apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G30570

ath:AT3G46290

ath:AT5G39000

ath:AT5G54380

ath:AT5G59700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.471

Rank 1 · LXL04_009140 · OH-1004

Cell membrane0.349

Rank 2 · LXL04_009140 · OH-1004

Nucleus0.266

Rank 3 · LXL04_009140 · OH-1004

Endoplasmic reticulum0.059

Rank 4 · LXL04_009140 · OH-1004

Golgi apparatus0.052

Rank 5 · LXL04_009140 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase14-103 aa

PF07714.24PK_Tyr_Ser-Thr17-104 aa

PF07714.24PK_Tyr_Ser-Thr103-242 aa

PF00069.32Pkinase108-240 aa

PF09280.17XPC-binding286-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009140	`PF00069.32`	Pkinase	14	103	1.9e-28	100.3
LXL04_009140	`PF07714.24`	PK_Tyr_Ser-Thr	17	104	8.2e-32	111.2
LXL04_009140	`PF07714.24`	PK_Tyr_Ser-Thr	103	242	8.2e-32	111.2
LXL04_009140	`PF00069.32`	Pkinase	108	240	1.9e-28	100.3
LXL04_009140	`PF09280.17`	XPC-binding	286	319	4.7e-07	30.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX66`	Arabidopsis thaliana	Receptor-like protein kinase HERK 1	37.201%	Swiss-Prot	moderate database homology
`Q9FN92`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g59700	37.374%	Swiss-Prot	moderate database homology
`Q9SA72`	Arabidopsis thaliana	Probable receptor-like protein kinase At1g30570	35.254%	Swiss-Prot	moderate database homology
`Q9LK35`	Arabidopsis thaliana	Receptor-like protein kinase THESEUS 1	35.640%	Swiss-Prot	moderate database homology
`Q9FID8`	Arabidopsis thaliana	Putative receptor-like protein kinase At5g39000	34.576%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card