LXL04_009138 | RubberDandelionOmics

Gene overview

LXL04_009138

Reference: OH-1004 Chr: Chr02 Coordinates: 118528374-118530297 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1314 bp · LXL04_009138|LXL04_009138|OH1004|cDNA

ATGGCCGATGATGCCGCAAGTACCAGCACCATTACTGGTAGAATGAACACCTCCATAACCGACATGTCACATGACCATCTCTTCTCCATCCTTCTGCTCCTGCCTCTGGAATCCATCCTGTCGTTTGCCATGACTTGTAAGAAAGCTACTCGCTTAACTCACTCCCACACTCTCTGGAAATCCATCTGCACCAGGGATTGGGGTCACTCCACCATCGATGCCTTCGTCAATTCTTCCTCCAATCCTCTTTCTGTCGACTG...

CDS

Download CDS FASTA

1314 bp · LXL04_009138|LXL04_009138|OH1004|CDS

ATGGCCGATGATGCCGCAAGTACCAGCACCATTACTGGTAGAATGAACACCTCCATAACCGACATGTCACATGACCATCTCTTCTCCATCCTTCTGCTCCTGCCTCTGGAATCCATCCTGTCGTTTGCCATGACTTGTAAGAAAGCTACTCGCTTAACTCACTCCCACACTCTCTGGAAATCCATCTGCACCAGGGATTGGGGTCACTCCACCATCGATGCCTTCGTCAATTCTTCCTCCAATCCTCTTTCTGTCGACTG...

Protein

Download Protein FASTA

437 aa · LXL04_009138|LXL04_009138|OH1004|PROTEIN

MADDAASTSTITGRMNTSITDMSHDHLFSILLLLPLESILSFAMTCKKATRLTHSHTLWKSICTRDWGHSTIDAFVNSSSNPLSVDWKRLYQRLRNLDRVSCYKLTDSETSPGSRASHSLNYFSGCLVLFGGGSEGGRHLDDTWVAYIGNNFRRMVSWQRVISEGPSGRFGHSCIVIGNSLVLFGGINDTGIRQNDTWMAQLDTTTTTLSWRLLDVGPVTPPTRGAHACCLIDSRRMLIHGGIGLFGTRLGDTWVLHLSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009138`
TK1151 ID	TkA03G400930
OH-1004 ID	LXL04_009138
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009138

Location Chr02:118528374-118530297 (+)

Description Similar to At1g51550: F-box/kelch-repeat protein At1g51550

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51550`	F-box/kelch-repeat protein At1g51550.	No verified direct reference in this release
`At5g57360`	Component of an E3 ubiquitin ligase complex that plays a central role in blue light-dependent circadian cycles.	LKP1 (LOV kelch protein 1): a factor involved in the regulation of flowering time in arabidopsis.2000 · DOI: 10.1046/j.1365-313x.2000.00850.x An Arabidopsis circadian clock component interacts with both CRY1 and phyB.2001 · DOI: 10.1038/35068589 LOV KELCH PROTEIN2 and ZEITLUPE repress Arabidopsis photoperiodic flowering under non-inductive conditions, dependent on FLAVIN-BINDING KELCH REPEAT F-BOX1.2011 · DOI: 10.1111/j.1365-313x.2011.04618.x
`At2g18915`	Component of an E3 ubiquitin ligase complex that plays a central role in blue light-dependent circadian cycles.	A role for LKP2 in the circadian clock of Arabidopsis.2001 · DOI: 10.1105/tpc.010332 LOV KELCH PROTEIN2 and ZEITLUPE repress Arabidopsis photoperiodic flowering under non-inductive conditions, dependent on FLAVIN-BINDING KELCH REPEAT F-BOX1.2011 · DOI: 10.1111/j.1365-313x.2011.04618.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0150800`	Component of an E3 ubiquitin ligase complex that plays a central role in blue light-dependent circadian cycles.	No verified direct reference in this release
`Os06g0694000`	Component of an E3 ubiquitin ligase complex that plays a central role in blue light-dependent circadian cycles.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009138 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009637 response to blue light Biological Process

GO:0009908 flower development Biological Process

GO:0010114 response to red light Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0043153 entrainment of circadian clock by photoperiod Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G51550

ath:AT2G18915

ath:AT5G57360

dosa:Os06g0694000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.582

Rank 1 · LXL04_009138 · OH-1004

Nucleus0.366

Rank 2 · LXL04_009138 · OH-1004

Peroxisome0.112

Rank 3 · LXL04_009138 · OH-1004

Mitochondrion0.084

Rank 4 · LXL04_009138 · OH-1004

Lysosome / Vacuole0.056

Rank 5 · LXL04_009138 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24681.2Kelch_KLHDC2_KLHL20_DRC796-260 aa

PF13415.13Beta-prop_FBX42101-261 aa

PF13418.13Beta-prop_TYW4112-190 aa

PF13854.13Kelch_HCF115-297 aa

PF24981.2Beta-prop_ATRN-LZTR1158-243 aa

PF24681.2Kelch_KLHDC2_KLHL20_DRC7205-323 aa

PF24981.2Beta-prop_ATRN-LZTR1237-412 aa

PF13415.13Beta-prop_FBX42266-372 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009138	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	96	260	1.6e-57	195.1
LXL04_009138	`PF13415.13`	Beta-prop_FBX42	101	261	2.6e-47	161.8
LXL04_009138	`PF13418.13`	Beta-prop_TYW4	112	190	3.4e-21	77.0
LXL04_009138	`PF13854.13`	Kelch_HCF	115	297	4e-21	76.4
LXL04_009138	`PF24981.2`	Beta-prop_ATRN-LZTR1	158	243	1.1e-29	104.3
LXL04_009138	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	205	323	1.6e-57	195.1
LXL04_009138	`PF24981.2`	Beta-prop_ATRN-LZTR1	237	412	1.1e-29	104.3
LXL04_009138	`PF13415.13`	Beta-prop_FBX42	266	372	2.6e-47	161.8
LXL04_009138	`PF13418.13`	Beta-prop_TYW4	276	412	3.4e-21	77.0
LXL04_009138	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	333	413	1.6e-57	195.1
LXL04_009138	`PF13854.13`	Kelch_HCF	339	414	4e-21	76.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8K7`	Arabidopsis thaliana	F-box/kelch-repeat protein At1g51550	53.483%	Swiss-Prot	strong database homology
`Q94BT6`	Arabidopsis thaliana	Adagio protein 1	30.127%	Swiss-Prot	moderate database homology
`Q8W420`	Arabidopsis thaliana	Adagio protein 2	30.500%	Swiss-Prot	moderate database homology
`Q67UX0`	Oryza sativa subsp. japonica	Putative adagio-like protein 2	30.203%	Swiss-Prot	moderate database homology
`Q5Z8K3`	Oryza sativa subsp. japonica	Adagio-like protein 1	29.873%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card