LXL04_008835 | RubberDandelionOmics

Gene overview

LXL04_008835

Reference: OH-1004 Chr: Chr02 Coordinates: 110013751-110017038 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2508 bp · LXL04_008835|LXL04_008835|OH1004|cDNA

ATGGAGTCAATTTCTGGAGATGAGTTTGACCCAAGTGATGAACTAGACTCAAATGCACGAGAAGAGAAGATTTTCGTTGCAGTGAGGCTTAGGCCTTTAAACGAAAAAGAAATTGCAAAAAACGATTTATCCGATTGGGAATGCATAAACAAAACCACCATCATATACAAAAGCAACAACCAATCAGACAGACCAATGTACCCAAACGCCTTCACTTTTGACCGAGTATACAGATATGACAGTACAACAAAACAAATATA...

CDS

Download CDS FASTA

2508 bp · LXL04_008835|LXL04_008835|OH1004|CDS

ATGGAGTCAATTTCTGGAGATGAGTTTGACCCAAGTGATGAACTAGACTCAAATGCACGAGAAGAGAAGATTTTCGTTGCAGTGAGGCTTAGGCCTTTAAACGAAAAAGAAATTGCAAAAAACGATTTATCCGATTGGGAATGCATAAACAAAACCACCATCATATACAAAAGCAACAACCAATCAGACAGACCAATGTACCCAAACGCCTTCACTTTTGACCGAGTATACAGATATGACAGTACAACAAAACAAATATA...

Protein

Download Protein FASTA

835 aa · LXL04_008835|LXL04_008835|OH1004|PROTEIN

MESISGDEFDPSDELDSNAREEKIFVAVRLRPLNEKEIAKNDLSDWECINKTTIIYKSNNQSDRPMYPNAFTFDRVYRYDSTTKQIYDEGVKTIALSVLNGINSSVFAYGQTSSGKTYTMSGITEFAIADIYDYINRHNDREFVMKFSAIEIYNECVKDLLSVDNTQLRLLDDPEKGTVVEKLTEANLRDCNHLKELIYMSEAERQIGETALNEMSSRSHQILRLTVESSALDFKGGDSGRSLSATVSFVDLAGSERASQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008835`
TK1151 ID	TkA03G324370
OH-1004 ID	LXL04_008835
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.800
Protein coverage (%)	TK1151 96.718 / OH-1004 60.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008835

Location Chr02:110013751-110017038 (-)

Description Similar to KIN7F: Kinesin-like protein KIN-7F

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51150`	Kinesin-like protein KIN-7G.	No verified direct reference in this release
`At2g21300`	Kinesin-like protein KIN-7E.	No verified direct reference in this release
`At5g66310`	Kinesin-like protein KIN-7H.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0538800`	Binds ATP/ADP in vitro.	No verified direct reference in this release
`Os02g0645100`	Kinesin-like protein KIN-7C.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008835 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007018 microtubule-based movement Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005874 microtubule Cellular Component

GO:0003777 microtubule motor activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008017 microtubule binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT2G21300

ath:AT3G51150

dosa:Os04g0538800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.692

Rank 1 · LXL04_008835 · OH-1004

Nucleus0.250

Rank 2 · LXL04_008835 · OH-1004

Cell membrane0.108

Rank 3 · LXL04_008835 · OH-1004

Golgi apparatus0.054

Rank 4 · LXL04_008835 · OH-1004

Lysosome / Vacuole0.053

Rank 5 · LXL04_008835 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796.12Microtub_bd25-161 aa

PF00225.30Kinesin29-346 aa

PF11995.14DUF3490673-818 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008835	`PF16796.12`	Microtub_bd	25	161	1.7e-19	71.0
LXL04_008835	`PF00225.30`	Kinesin	29	346	2e-96	323.5
LXL04_008835	`PF11995.14`	DUF3490	673	818	7.8e-57	192.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J394`	Arabidopsis thaliana	Kinesin-like protein KIN-7G	64.976%	Swiss-Prot	weak database homology
`F4IGL2`	Arabidopsis thaliana	Kinesin-like protein KIN-7E	62.415%	Swiss-Prot	moderate database homology
`F4JZ68`	Arabidopsis thaliana	Kinesin-like protein KIN-7H	56.855%	Swiss-Prot	moderate database homology
`Q7X7H4`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-7F	65.138%	Swiss-Prot	moderate database homology
`Q6H638`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-7C	59.329%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card