LXL04_008691 | RubberDandelionOmics

Gene overview

LXL04_008691

Reference: OH-1004 Chr: Chr02 Coordinates: 106373733-106377312 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2974 bp · LXL04_008691|LXL04_008691|OH1004|cDNA

ATGTCTCTCGTCGCCTTCAACATGTGTATAAAGCGTTTCGTCACTTCTCTCATCCATCAATTGGAAAAAATCTCCAAATACGTGAGTAAATTCGCACAAGCAAATCTTCATAGAAACGCACTCATACTCGCTAGTTCGAGTCGTTTGATTCTGATTGGTTTCGTACGCCGTTGAAGGAACATTTTAAGGTAACAATATATCTCTTCTTCCTGGTTTATACGAGTCATTATCCGAAATGAATCCCGACAAATTCACCCACA...

CDS

Download CDS FASTA

2739 bp · LXL04_008691|LXL04_008691|OH1004|CDS

ATGAATCCCGACAAATTCACCCACAAGACAAACGAGGCGTTGGCTTCAGGCCATGAACTCGCAATGAATGCCGGACACGCCCAATTCACACCGCTACATATTGCAGCAGCTCTAATCTCCGACCCTAACGGCATATTCCGGCAAGCAGTAAGCAATGCCGGCGGTGAAGAAGCAGGCAATTCAGCCGAGAGGGTTTTCAATCAAGCATTGAAGAAACTTCCTTCCCAGTCCCCTGCTCCTGACGAAGTTCCAGCAAGTAC...

Protein

Download Protein FASTA

912 aa · LXL04_008691|LXL04_008691|OH1004|PROTEIN

MNPDKFTHKTNEALASGHELAMNAGHAQFTPLHIAAALISDPNGIFRQAVSNAGGEEAGNSAERVFNQALKKLPSQSPAPDEVPASTSLIKTIRRAQSSQKSRGDTHLAVDQLILGLLEDSQISELLKESGVGASRVKSEVEKLRGKEGKKVESASGDTNFQALKTYGRDLVEQAGKLDPVIGRDEEIRRVIRILSRRTKNNPVLIGEPGVGKTAVVEGLAQRILRGDVPSNLADVRVVALDMGALIAGAKYRGEFEERL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008691`
TK1151 ID	TkA03G344420
OH-1004 ID	LXL04_008691
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 99.606 / OH-1004 83.114 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008691

Location Chr02:106373733-106377312 (+)

Description Similar to CLPB1: Chaperone protein ClpB1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74310`	Molecular chaperone that plays an important role in thermotolerance.	Heat shock protein 101 plays a crucial role in thermotolerance in Arabidopsis.2000 · DOI: 10.1105/tpc.12.4.479 Mutants of Arabidopsis thaliana defective in the acquisition of tolerance to high temperature stress.2000 · DOI: 10.1073/pnas.97.8.4392 Hsp101 is necessary for heat tolerance but dispensable for development and germination in the absence of stress.2001 · DOI: 10.1046/j.1365-313x.2001.01066.x Genetic analysis reveals domain interactions of Arabidopsis Hsp100/ClpB and cooperation with the small heat shock protein chaperone system.2005 · DOI: 10.1105/tpc.104.027540 The Arabidopsis ClpB/Hsp100 family of proteins: chaperones for stress and chloroplast development.2007 · DOI: 10.1111/j.1365-313x.2006.02940.x Interplay between heat shock proteins HSP101 and HSA32 prolongs heat acclimation memory posttranscriptionally in Arabidopsis.2013 · DOI: 10.1104/pp.112.212589 An Arabidopsis heat shock protein complements a thermotolerance defect in yeast.1994 · DOI: 10.1105/tpc.6.12.1899

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0519700`	Molecular chaperone involved in heat stress response.	Molecular characterization of rice hsp101: complementation of yeast hsp104 mutation by disaggregation of protein granules and differential expression in indica and japonica rice types.2003 · DOI: 10.1023/a:1022324920316

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008691 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0042026 protein refolding Biological Process

GO:0043335 protein unfolding Biological Process

GO:0045727 positive regulation of translation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT1G74310

dosa:Os05g0519700

dvu:DVU_1874

gvi:gll3577

syf:Synpcc7942_1089

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.604

Rank 1 · LXL04_008691 · OH-1004

Nucleus0.341

Rank 2 · LXL04_008691 · OH-1004

Cell membrane0.118

Rank 3 · LXL04_008691 · OH-1004

Mitochondrion0.065

Rank 4 · LXL04_008691 · OH-1004

Endoplasmic reticulum0.059

Rank 5 · LXL04_008691 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02861.26Clp_N5-129 aa

PF13191.13AAA_16181-232 aa

PF23569.2NBD_SMAX1185-287 aa

PF13401.13AAA_22198-299 aa

PF00004.36AAA204-317 aa

PF17871.8AAA_lid_9343-444 aa

PF00158.33Sigma54_activat593-717 aa

PF07724.21AAA_2597-761 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008691	`PF02861.26`	Clp_N	5	129	3.1e-28	99.2
LXL04_008691	`PF13191.13`	AAA_16	181	232	1.6e-10	42.5
LXL04_008691	`PF23569.2`	NBD_SMAX1	185	287	1.7e-09	38.5
LXL04_008691	`PF13401.13`	AAA_22	198	299	5e-13	50.2
LXL04_008691	`PF00004.36`	AAA	204	317	5.1e-25	89.2
LXL04_008691	`PF17871.8`	AAA_lid_9	343	444	2.3e-34	118.2
LXL04_008691	`PF00158.33`	Sigma54_activat	593	717	2.1e-09	38.0
LXL04_008691	`PF07724.21`	AAA_2	597	761	1.6e-71	240.4
LXL04_008691	`PF13401.13`	AAA_22	599	696	5e-13	50.2
LXL04_008691	`PF07728.21`	AAA_5	601	722	4e-17	63.2
LXL04_008691	`PF00004.36`	AAA	602	720	5.1e-25	89.2
LXL04_008691	`PF10431.16`	ClpB_D2-small	767	846	5.3e-22	78.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42730`	Arabidopsis thaliana	Chaperone protein ClpB1	84.684%	Swiss-Prot	strong database homology
`Q6F2Y7`	Oryza sativa subsp. japonica	Chaperone protein ClpB1	83.151%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card