LXL04_008682 | RubberDandelionOmics

Gene overview

LXL04_008682

Reference: OH-1004 Chr: Chr02 Coordinates: 106138581-106145945 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1062 bp · LXL04_008682|LXL04_008682|OH1004|cDNA

TTTGGACTAAATTGGCATTGCGTCAGTTTGGCGCGTCATGTGGGCCATCCTATCACGGTGCGCGCCATATCATCGGCGCAACTCCCAACCCGATCAAAAGTCTTCGCTATTTTCGTCATCATATTCATCGCCGTAGACGTCTTCTTCAACCCACTTCGAACGACTCCACTTTCTTCAACCTACAAAACTCCTAATTTTGTTGACTTCTCTTTCCGATTAATATTCCTCCGACCAAATTGTAAGACCTCTCCGTCGCGATT...

CDS

Download CDS FASTA

1035 bp · LXL04_008682|LXL04_008682|OH1004|CDS

TTGGCGCGTCATGTGGGCCATCCTATCACGGTGCGCGCCATATCATCGGCGCAACTCCCAACCCGATCAAAAGTCTTCGCTATTTTCGTCATCATATTCATCGCCGTAGACGTCTTCTTCAACCCACTTCGAACGACTCCACTTTCTTCAACCTACAAAACTCCTAATTTTGTTGACTTCTCTTTCCGATTAATATTCCTCCGACCAAATTGTAAGACCTCTCCGTCGCGATTAATCCGACGGTGGAGAATGGGATGTTT...

Protein

Download Protein FASTA

344 aa · LXL04_008682|LXL04_008682|OH1004|PROTEIN

MARHVGHPITVRAISSAQLPTRSKVFAIFVIIFIAVDVFFNPLRTTPLSSTYKTPNFVDFSFRLIFLRPNCKTSPSRLIRRWRMGCFASKSADSKASRLSRWRATGIVALRDGKLKSFPDEVLELDKSVRTLDLTHNKLVDVPEEISKLINMQRLILANNVIERLPMNLGKLKSLKFIILDGNKLTTLPDEVGQLVRLERLSISGNLLTGLPETIGSLRNLLLLNVSSNKIKSLPESIGSCFSLEELQANENSIEELPTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008682`
TK1151 ID	TkA03G344780
OH-1004 ID	LXL04_008682
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 97.727 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008682

Location Chr02:106138581-106145945 (-)

Description Similar to IRL7: Plant intracellular Ras-group-related LRR protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30105`	LRR repeats and ubiquitin-like domain-containing protein At2g30105.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0212200`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release
`Os10g0456200`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008682 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0035556 intracellular signal transduction Biological Process

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G30105

dosa:Os03g0212200

dosa:Os10g0456200

xla:432302

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.486

Rank 1 · LXL04_008682 · OH-1004

Nucleus0.275

Rank 2 · LXL04_008682 · OH-1004

Cell membrane0.144

Rank 3 · LXL04_008682 · OH-1004

Golgi apparatus0.111

Rank 4 · LXL04_008682 · OH-1004

Mitochondrion0.106

Rank 5 · LXL04_008682 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_14110-176 aa

PF12799.14LRR_4127-163 aa

PF13855.13LRR_8128-185 aa

PF12799.14LRR_4151-189 aa

PF23598.2LRR_14168-248 aa

PF13855.13LRR_8197-254 aa

PF12799.14LRR_4197-235 aa

PF23598.2LRR_14224-299 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008682	`PF23598.2`	LRR_14	110	176	3.6e-23	82.6
LXL04_008682	`PF12799.14`	LRR_4	127	163	2.5e-16	60.0
LXL04_008682	`PF13855.13`	LRR_8	128	185	4.3e-20	72.0
LXL04_008682	`PF12799.14`	LRR_4	151	189	2.5e-16	60.0
LXL04_008682	`PF23598.2`	LRR_14	168	248	3.6e-23	82.6
LXL04_008682	`PF13855.13`	LRR_8	197	254	4.3e-20	72.0
LXL04_008682	`PF12799.14`	LRR_4	197	235	2.5e-16	60.0
LXL04_008682	`PF23598.2`	LRR_14	224	299	3.6e-23	82.6
LXL04_008682	`PF13855.13`	LRR_8	243	301	4.3e-20	72.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C895`	Arabidopsis thaliana	LRR repeats and ubiquitin-like domain-containing protein At2g30105	38.800%	Swiss-Prot	moderate database homology
`B9F655`	Oryza sativa subsp. japonica	Plant intracellular Ras-group-related LRR protein 7	63.218%	Swiss-Prot	strong database homology
`Q7XDQ7`	Oryza sativa subsp. japonica	Plant intracellular Ras-group-related LRR protein 8	38.996%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card