LXL04_008672 | RubberDandelionOmics

Gene overview

LXL04_008672

Reference: OH-1004 Chr: Chr02 Coordinates: 105792347-105794262 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1377 bp · LXL04_008672|LXL04_008672|OH1004|cDNA

ATGGTTTCAGCAAGAAATCCACCGAGAAACGTGTGTGTTATTGGTGCTGGGCCATCGGGGTTGGTTGCCGCCAGGGAGTTAAGAAAAGAAGGGCAcacggtggtggtggtggaacagAATCATGATGTCGGAGGTCAATGGCTCTATGACCCCAAAGTTGAAGGCGAAGATCCTTTAGGAAAAGGCAAGGCTTTAAACGTTCATAGCAGTATCTATGAGTCACTAAGACTCACGTCCCCAAGAGAGATAATGGGGTTCAC...

CDS

Download CDS FASTA

1377 bp · LXL04_008672|LXL04_008672|OH1004|CDS

ATGGTTTCAGCAAGAAATCCACCGAGAAACGTGTGTGTTATTGGTGCTGGGCCATCGGGGTTGGTTGCCGCCAGGGAGTTAAGAAAAGAAGGGCACACGGTGGTGGTGGTGGAACAGAATCATGATGTCGGAGGTCAATGGCTCTATGACCCCAAAGTTGAAGGCGAAGATCCTTTAGGAAAAGGCAAGGCTTTAAACGTTCATAGCAGTATCTATGAGTCACTAAGACTCACGTCCCCAAGAGAGATAATGGGGTTCAC...

Protein

Download Protein FASTA

458 aa · LXL04_008672|LXL04_008672|OH1004|PROTEIN

MVSARNPPRNVCVIGAGPSGLVAARELRKEGHTVVVVEQNHDVGGQWLYDPKVEGEDPLGKGKALNVHSSIYESLRLTSPREIMGFTDFPFLIKKGRDSRRFPGHKELLLYLKDFCEWFGLRDMIRFNTRVEHVGMLDYGEFGKELRWVVESKAKDSDKVVSEVFDAVVVATGHYSHPRLPSIKGMDAWRRKQMHSHLYRVPEPFRNQVVVVVGNSLSGQDISMELVNVAKEIHLCSKSLHVSEGLSKVLSKHDNLHLHP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008672`
TK1151 ID	TkA03G346720
OH-1004 ID	LXL04_008672
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008672

Location Chr02:105792347-105794262 (-)

Description Similar to At5g07800: Flavin-containing monooxygenase FMO GS-OX-like 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07800`	Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release
`At5g61290`	Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release
`At1g62620`	Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release
`At1g63370`	Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release
`At1g12200`	Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008672 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0004499 N,N-dimethylaniline monooxygenase activity Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

GO:0050661 NADP binding Molecular Function

KEGG gene cross-reference

ath:AT1G12200

ath:AT1G62620

ath:AT1G63370

ath:AT5G07800

ath:AT5G61290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.743

Rank 1 · LXL04_008672 · OH-1004

Nucleus0.276

Rank 2 · LXL04_008672 · OH-1004

Endoplasmic reticulum0.068

Rank 3 · LXL04_008672 · OH-1004

Mitochondrion0.067

Rank 4 · LXL04_008672 · OH-1004

Cell membrane0.066

Rank 5 · LXL04_008672 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00743.26FMO-like10-238 aa

PF07992.21Pyr_redox_210-305 aa

PF03486.21HI0933_like10-44 aa

PF01494.26FAD_binding_310-41 aa

PF01266.31DAO11-45 aa

PF12831.14FAD_oxidored11-47 aa

PF00890.31FAD_binding_211-46 aa

PF13450.13NAD_binding_813-47 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008672	`PF00743.26`	FMO-like	10	238	4.7e-49	168.0
LXL04_008672	`PF07992.21`	Pyr_redox_2	10	305	7.1e-17	62.5
LXL04_008672	`PF03486.21`	HI0933_like	10	44	3.7e-07	30.6
LXL04_008672	`PF01494.26`	FAD_binding_3	10	41	4e-06	27.0
LXL04_008672	`PF01266.31`	DAO	11	45	1.2e-10	42.2
LXL04_008672	`PF12831.14`	FAD_oxidored	11	47	4.1e-06	27.1
LXL04_008672	`PF00890.31`	FAD_binding_2	11	46	4.6e-06	26.8
LXL04_008672	`PF13450.13`	NAD_binding_8	13	47	2.4e-10	41.2
LXL04_008672	`PF13738.13`	Pyr_redox_3	61	312	6.5e-22	78.9
LXL04_008672	`PF00743.26`	FMO-like	269	400	4.7e-49	168.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FF12`	Arabidopsis thaliana	Flavin-containing monooxygenase FMO GS-OX-like 9	71.429%	Swiss-Prot	strong database homology
`Q9FLK4`	Arabidopsis thaliana	Flavin-containing monooxygenase FMO GS-OX-like 8	69.866%	Swiss-Prot	strong database homology
`Q9SXD5`	Arabidopsis thaliana	Flavin-containing monooxygenase FMO GS-OX-like 3	48.889%	Swiss-Prot	moderate database homology
`Q9C8U0`	Arabidopsis thaliana	Flavin-containing monooxygenase FMO GS-OX-like 5	48.667%	Swiss-Prot	moderate database homology
`Q9FWW9`	Arabidopsis thaliana	Flavin-containing monooxygenase FMO GS-OX-like 2	50.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card