LXL04_008653 | RubberDandelionOmics

Gene overview

LXL04_008653

Reference: OH-1004 Chr: Chr02 Coordinates: 105299027-105299437 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · LXL04_008653|LXL04_008653|OH1004|cDNA

ATGGCGGCTCAACCACGCGATGAAGCCAGTGTCACTGAACCTTGCCGTGTGGAGAATGGGCCGGGTAAGAAGAAGGAGTTGGGAGTGAACCCGAAGGTTATGATGGAAAGATTAGGAACCTTTTGGGATCCTGATGATCAAAGGGAGAGTCTTGAGTTAGAAGAGATGGTGAATCTGTTCGTTGGTGATGAGCCAAGCTTTGATGAAGTGAAAGAGGCGTTTGGCGTGTATGATAAGAACAACGATGGGTACATAGATGC...

CDS

Download CDS FASTA

411 bp · LXL04_008653|LXL04_008653|OH1004|CDS

ATGGCGGCTCAACCACGCGATGAAGCCAGTGTCACTGAACCTTGCCGTGTGGAGAATGGGCCGGGTAAGAAGAAGGAGTTGGGAGTGAACCCGAAGGTTATGATGGAAAGATTAGGAACCTTTTGGGATCCTGATGATCAAAGGGAGAGTCTTGAGTTAGAAGAGATGGTGAATCTGTTCGTTGGTGATGAGCCAAGCTTTGATGAAGTGAAAGAGGCGTTTGGCGTGTATGATAAGAACAACGATGGGTACATAGATGC...

Protein

Download Protein FASTA

136 aa · LXL04_008653|LXL04_008653|OH1004|PROTEIN

MAAQPRDEASVTEPCRVENGPGKKKELGVNPKVMMERLGTFWDPDDQRESLELEEMVNLFVGDEPSFDEVKEAFGVYDKNNDGYIDATELQSVLSDMGFLHFSESECEKMITGYDVDKDGKISFREFFKVVEDGFC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008653`
TK1151 ID	TkA03G348850
OH-1004 ID	LXL04_008653
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008653

Location Chr02:105299027-105299437 (-)

Description Similar to CML45: Probable calcium-binding protein CML45

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g29000`	Potential calcium sensor.	No verified direct reference in this release
`At5g39670`	Potential calcium sensor.	No verified direct reference in this release
`At3g47480`	Potential calcium sensor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008653 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016460 myosin II complex Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G29000

ath:AT3G47480

ath:AT5G39670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.641

Rank 1 · LXL04_008653 · OH-1004

Nucleus0.388

Rank 2 · LXL04_008653 · OH-1004

Cell membrane0.083

Rank 3 · LXL04_008653 · OH-1004

Endoplasmic reticulum0.075

Rank 4 · LXL04_008653 · OH-1004

Mitochondrion0.060

Rank 5 · LXL04_008653 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499.13EF-hand_768-131 aa

PF00036.39EF-hand_169-96 aa

PF13405.13EF-hand_669-98 aa

PF13202.13EF-hand_571-94 aa

PF13833.13EF-hand_882-133 aa

PF00036.39EF-hand_1106-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008653	`PF13499.13`	EF-hand_7	68	131	7.7e-13	49.3
LXL04_008653	`PF00036.39`	EF-hand_1	69	96	4.7e-15	54.6
LXL04_008653	`PF13405.13`	EF-hand_6	69	98	2.4e-13	49.2
LXL04_008653	`PF13202.13`	EF-hand_5	71	94	6.1e-12	45.2
LXL04_008653	`PF13833.13`	EF-hand_8	82	133	1.5e-09	38.2
LXL04_008653	`PF00036.39`	EF-hand_1	106	132	4.7e-15	54.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MBG5`	Arabidopsis thaliana	Probable calcium-binding protein CML45	44.340%	Swiss-Prot	moderate database homology
`Q93Z27`	Arabidopsis thaliana	Probable calcium-binding protein CML46	41.121%	Swiss-Prot	moderate database homology
`Q9SN89`	Arabidopsis thaliana	Probable calcium-binding protein CML47	50.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card