LXL04_008464 | RubberDandelionOmics

Gene overview

LXL04_008464

Reference: OH-1004 Chr: Chr02 Coordinates: 100307729-100308420 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

522 bp · LXL04_008464|LXL04_008464|OH1004|cDNA

ATGGAAAATGAAGAGGATCCAGTGAAGAGGCAGCAGATTCTTGATGCACGTGCAAGAAACATCAGTCACAATGTGCGATGCTTAGAGTGTGGTAGTCAGTCCATTGAAGAATCCCAAGCTGATATTGCTGTTCTCCTCAGAAAGCTTATTCGTGATGAAATCCGATCTGGAAAAAGTGACAAAGATATTTATAAGAAGCTTGAAGATGATTATGGGGAGACGATTCTTTATGCTCCAAAGTTTGATTGGCAGACTGCCGC...

CDS

Download CDS FASTA

522 bp · LXL04_008464|LXL04_008464|OH1004|CDS

ATGGAAAATGAAGAGGATCCAGTGAAGAGGCAGCAGATTCTTGATGCACGTGCAAGAAACATCAGTCACAATGTGCGATGCTTAGAGTGTGGTAGTCAGTCCATTGAAGAATCCCAAGCTGATATTGCTGTTCTCCTCAGAAAGCTTATTCGTGATGAAATCCGATCTGGAAAAAGTGACAAAGATATTTATAAGAAGCTTGAAGATGATTATGGGGAGACGATTCTTTATGCTCCAAAGTTTGATTGGCAGACTGCCGC...

Protein

Download Protein FASTA

173 aa · LXL04_008464|LXL04_008464|OH1004|PROTEIN

MENEEDPVKRQQILDARARNISHNVRCLECGSQSIEESQADIAVLLRKLIRDEIRSGKSDKDIYKKLEDDYGETILYAPKFDWQTAAFWLSPLLIAGTAGGIWAYGRHRQRTNVHLLALNITRGVPLTPKEKETMLDVLTPPPSGILPSSSPWWRQWVPQLTNSSSKGNNYAR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008464`
TK1151 ID	TkA03G369670
OH-1004 ID	LXL04_008464
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 99.422 / OH-1004 99.422 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008464

Location Chr02:100307729-100308420 (-)

Description Similar to CCMH: Cytochrome c-type biogenesis CcmH-like mitochondrial protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15220`	Plays a central role in mitochondrial cytochrome c maturation.	AtCCMH, an essential component of the c-type cytochrome maturation pathway in Arabidopsis mitochondria, interacts with apocytochrome c.2005 · DOI: 10.1073/pnas.0503473102 The three mitochondrial encoded CcmF proteins form a complex that interacts with CCMH and c-type apocytochromes in Arabidopsis.2008 · DOI: 10.1074/jbc.m802621200

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AFK5`	Plays a role in mitochondrial cytochrome c maturation.	No verified direct reference in this release
`Os02g0275100`	Plays a role in mitochondrial cytochrome c maturation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008464 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0017004 cytochrome complex assembly Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G15220

dosa:Os02g0275100

rcp:RCAP_rcc03137

sme:SMc02364

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.338

Rank 1 · LXL04_008464 · OH-1004

Cytoplasm0.213

Rank 2 · LXL04_008464 · OH-1004

Cell membrane0.188

Rank 3 · LXL04_008464 · OH-1004

Endoplasmic reticulum0.173

Rank 4 · LXL04_008464 · OH-1004

Golgi apparatus0.127

Rank 5 · LXL04_008464 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03918.20CcmH7-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008464	`PF03918.20`	CcmH	7	114	7.8e-28	97.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XI46`	Arabidopsis thaliana	Cytochrome c-type biogenesis CcmH-like mitochondrial protein	64.968%	Swiss-Prot	strong database homology
`B8AFK5`	Oryza sativa subsp. indica	Cytochrome c-type biogenesis CcmH-like mitochondrial protein	74.026%	Swiss-Prot	strong database homology
`Q6K7S7`	Oryza sativa subsp. japonica	Cytochrome c-type biogenesis CcmH-like mitochondrial protein	74.026%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card