LXL04_008438 | RubberDandelionOmics

Gene overview

LXL04_008438

Reference: OH-1004 Chr: Chr02 Coordinates: 99758407-99764652 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2604 bp · LXL04_008438|LXL04_008438|OH1004|cDNA

ATGGCATCTCAATGTATATTCGCTTCGTCGTTGTTCCCCTCAACTTCCTTATCACGTCGACTACAATCTCGAAGAATTAGACGCTTACCTAACGCTAATTCATCAATTACATGTCACCTAAATAACTCAGAAGCCGAAGAAGAATCCAAAAACAAGATAAACGCATTGAATTTGCTCCAAATCTCTGTAACCCTAACCGTAATATCGGCTTCACTACCCCAGCCCGTATTAGCAGCAGCCAAAGTTACACAAAAGAAGCG...

CDS

Download CDS FASTA

2604 bp · LXL04_008438|LXL04_008438|OH1004|CDS

ATGGCATCTCAATGTATATTCGCTTCGTCGTTGTTCCCCTCAACTTCCTTATCACGTCGACTACAATCTCGAAGAATTAGACGCTTACCTAACGCTAATTCATCAATTACATGTCACCTAAATAACTCAGAAGCCGAAGAAGAATCCAAAAACAAGATAAACGCATTGAATTTGCTCCAAATCTCTGTAACCCTAACCGTAATATCGGCTTCACTACCCCAGCCCGTATTAGCAGCAGCCAAAGTTACACAAAAGAAGCG...

Protein

Download Protein FASTA

867 aa · LXL04_008438|LXL04_008438|OH1004|PROTEIN

MASQCIFASSLFPSTSLSRRLQSRRIRRLPNANSSITCHLNNSEAEEESKNKINALNLLQISVTLTVISASLPQPVLAAAKVTQKKRPPKKTHTLTPEELKAWSQGLPVVANRIPYTDILNLKRDGKLKHIIKPPGRGLKERPVVVLAVLEDSKVVRLVVPSIDIDDKFWESWDAMGIDSICVQAYTPPVKMPEVPRPYLGFLAQFPSWMFSQAKPKPVSKKVLELRKAREELKRSRSNEMLNSKREIAKMEKAMRAQKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008438`
TK1151 ID	TkA03G371980
OH-1004 ID	LXL04_008438
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.400
Protein coverage (%)	TK1151 100.000 / OH-1004 99.769 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008438

Location Chr02:99758407-99764652 (+)

Description Similar to FTSHI2: Probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16290`	Required for plastid development during embryogenesis.	FtsHi4 is essential for embryogenesis due to its influence on chloroplast development in Arabidopsis.2014 · DOI: 10.1371/journal.pone.0099741

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008438 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0045037 protein import into chloroplast stroma Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0062091 Ycf2/FtsHi complex Cellular Component

GO:0004176 ATP-dependent peptidase activity Molecular Function

GO:0004222 metalloendopeptidase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G16290

cyb:CYB_0631

pak:HMPREF0675_3307

sth:STH3198

syn:slr1604

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.825

Rank 1 · LXL04_008438 · OH-1004

Mitochondrion0.137

Rank 2 · LXL04_008438 · OH-1004

Nucleus0.048

Rank 3 · LXL04_008438 · OH-1004

Cytoplasm0.024

Rank 4 · LXL04_008438 · OH-1004

Cell membrane0.018

Rank 5 · LXL04_008438 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00004.36AAA446-578 aa

PF17862.8AAA_lid_3601-644 aa

PF01434.25Peptidase_M41665-834 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008438	`PF00004.36`	AAA	446	578	1.5e-42	145.8
LXL04_008438	`PF17862.8`	AAA_lid_3	601	644	1.1e-10	41.6
LXL04_008438	`PF01434.25`	Peptidase_M41	665	834	3.3e-12	47.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A8MPR5`	Arabidopsis thaliana	Probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic	71.346%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card