LXL04_008092 | RubberDandelionOmics

Gene overview

LXL04_008092

Reference: OH-1004 Chr: Chr02 Coordinates: 85543788-85546128 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1998 bp · LXL04_008092|LXL04_008092|OH1004|cDNA

ATGACACCAACCTGCATTTATACTGCCATTGTTCTCCTCTACTTTTTCACCCTAACTGTAGCAACTTTAAATCTCTCTTCGACACCGGAGAAAGATGCTTTATCTATTCTCGAATTCAAATCCAAAGCCGATCTCCGTAACAAGCTTCCCTATTCCGTTAAAACGAGCTCCACTCTCTGCAAATGGCAGGGAGTACAATGCCAGGCCGACGGTAAGGTTGTGCGACTTGTTGTTGAAAACTTCGGCCTCGCTGGTGTTTT...

CDS

Download CDS FASTA

1998 bp · LXL04_008092|LXL04_008092|OH1004|CDS

ATGACACCAACCTGCATTTATACTGCCATTGTTCTCCTCTACTTTTTCACCCTAACTGTAGCAACTTTAAATCTCTCTTCGACACCGGAGAAAGATGCTTTATCTATTCTCGAATTCAAATCCAAAGCCGATCTCCGTAACAAGCTTCCCTATTCCGTTAAAACGAGCTCCACTCTCTGCAAATGGCAGGGAGTACAATGCCAGGCCGACGGTAAGGTTGTGCGACTTGTTGTTGAAAACTTCGGCCTCGCTGGTGTTTT...

Protein

Download Protein FASTA

665 aa · LXL04_008092|LXL04_008092|OH1004|PROTEIN

MTPTCIYTAIVLLYFFTLTVATLNLSSTPEKDALSILEFKSKADLRNKLPYSVKTSSTLCKWQGVQCQADGKVVRLVVENFGLAGVFAPNTLTRLDQLRVLSLQSNSLTGPIPDLAGLVNLKTLFLDHNSFTGVIPPSISSLHRLRTLDLSYNRLSGVIPVGLASLDRLNYLRLDSNRFNGSIPPLNQSSLQIFNVSLNSLTGPIPVTRSLAKFAASSFWSNPGLCGEIVRTECSIIGPFFGKNSTVTSTLTPPPRVVLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008092`
TK1151 ID	TkA08G125190
OH-1004 ID	LXL04_008092
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	62.900
Protein coverage (%)	TK1151 99.062 / OH-1004 98.797 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008092

Location Chr02:85543788-85546128 (+)

Description Similar to At5g67200: Probable inactive receptor kinase At5g67200

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67200`	Probable inactive receptor kinase At5g67200.	No verified direct reference in this release
`At1g60630`	Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630.	No verified direct reference in this release
`At2g26730`	Probable inactive receptor kinase At2g26730.	No verified direct reference in this release
`At1g68400`	Probable leucine-rich repeat receptor-like protein kinase At1g68400.	No verified direct reference in this release
`At5g05160`	Probable leucine-rich repeat receptor-like protein kinase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008092 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:2000605 positive regulation of secondary growth Biological Process

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G60630

ath:AT1G68400

ath:AT2G26730

ath:AT5G05160

ath:AT5G67200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.882

Rank 1 · LXL04_008092 · OH-1004

Cytoplasm0.075

Rank 2 · LXL04_008092 · OH-1004

Endoplasmic reticulum0.074

Rank 3 · LXL04_008092 · OH-1004

Nucleus0.061

Rank 4 · LXL04_008092 · OH-1004

Golgi apparatus0.018

Rank 5 · LXL04_008092 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_888-130 aa

PF23598.2LRR_1492-178 aa

PF12799.14LRR_497-131 aa

PF13855.13LRR_8120-179 aa

PF12799.14LRR_4144-187 aa

PF07714.24PK_Tyr_Ser-Thr386-640 aa

PF00069.32Pkinase386-589 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008092	`PF13855.13`	LRR_8	88	130	3.6e-13	49.8
LXL04_008092	`PF23598.2`	LRR_14	92	178	1e-06	28.5
LXL04_008092	`PF12799.14`	LRR_4	97	131	2.1e-11	44.4
LXL04_008092	`PF13855.13`	LRR_8	120	179	3.6e-13	49.8
LXL04_008092	`PF12799.14`	LRR_4	144	187	2.1e-11	44.4
LXL04_008092	`PF07714.24`	PK_Tyr_Ser-Thr	386	640	4.2e-29	102.4
LXL04_008092	`PF00069.32`	Pkinase	386	589	1.6e-27	97.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y06`	Arabidopsis thaliana	Probable inactive receptor kinase At5g67200	54.460%	Swiss-Prot	strong database homology
`Q84MA9`	Arabidopsis thaliana	Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630	41.745%	Swiss-Prot	moderate database homology
`O48788`	Arabidopsis thaliana	Probable inactive receptor kinase At2g26730	35.855%	Swiss-Prot	moderate database homology
`Q9M9C5`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At1g68400	37.942%	Swiss-Prot	moderate database homology
`Q9FHK7`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g05160	34.992%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card