LXL04_007478 | RubberDandelionOmics

Gene overview

LXL04_007478

Reference: OH-1004 Chr: Chr02 Coordinates: 49713307-49717594 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2277 bp · LXL04_007478|LXL04_007478|OH1004|cDNA

ACTTTCGATCTCGTGGTTGGGTCAATACTCAATACGGTTCTGATACCGACAAAGGTTTCGGGGCAAGTAGTTGACGACGCTCCATCGTCTGAATTTCATAGTGAAGCAATCTTTCCCCATTGTACCGACCATATCATGGTGGCTAGAAAGTTCCTCATCCACCACCAAGATTCCAACTTTGATGTCGACTACGACACTGAAGATGGTTTTGAAGTCTTCAAATTCCAGTTGTTTTCCCTCACGGCAGTTCCTCCAGATGA...

CDS

Download CDS FASTA

2238 bp · LXL04_007478|LXL04_007478|OH1004|CDS

CTGATACCGACAAAGGTTTCGGGGCAAGTAGTTGACGACGCTCCATCGTCTGAATTTCATAGTGAAGCAATCTTTCCCCATTGTACCGACCATATCATGGTGGCTAGAAAGTTCCTCATCCACCACCAAGATTCCAACTTTGATGTCGACTACGACACTGAAGATGGTTTTGAAGTCTTCAAATTCCAGTTGTTTTCCCTCACGGCAGTTCCTCCAGATGAGCAAAAGATATTCGCAGGTGACGACGATCGAATTGTTTC...

Protein

Download Protein FASTA

745 aa · LXL04_007478|LXL04_007478|OH1004|PROTEIN

MIPTKVSGQVVDDAPSSEFHSEAIFPHCTDHIMVARKFLIHHQDSNFDVDYDTEDGFEVFKFQLFSLTAVPPDEQKIFAGDDDRIVSNDSDLIAISDKLRLVSIKDENPQLDSEIVKSDEELARMLQAEEEALMLQQFAVSQDNGQFQQKIRPYVDQVLLYEDVRRQVAAKNTVPLETLQEKALVALAKEGNFKPSKPEVDHAFLLQLLFWFKQSFKWVNSPPCEDCGNETTNQGMGVPNSSESASLASRVELYSCKACP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007478`
TK1151 ID	TkA03G181140
OH-1004 ID	LXL04_007478
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 98.285 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007478

Location Chr02:49713307-49717594 (-)

Description Similar to PNG1: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49570`	Specifically deglycosylates the denatured form of N-linked glycoproteins in the cytoplasm and assists their proteasome-mediated degradation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0497400`	Specifically deglycosylates the denatured form of N-linked glycoproteins in the cytoplasm and assists their proteasome-mediated degradation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007478 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006516 glycoprotein catabolic process Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010188 response to microbial phytotoxin Biological Process

GO:0010193 response to ozone Biological Process

GO:0042176 regulation of protein catabolic process Biological Process

GO:1903332 regulation of protein folding Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000224 peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G49570

dosa:Os07g0497400

dre:553627

gga:420655

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.580

Rank 1 · LXL04_007478 · OH-1004

Nucleus0.390

Rank 2 · LXL04_007478 · OH-1004

Cell membrane0.076

Rank 3 · LXL04_007478 · OH-1004

Mitochondrion0.075

Rank 4 · LXL04_007478 · OH-1004

Golgi apparatus0.066

Rank 5 · LXL04_007478 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01841.26Transglut_core243-327 aa

PF03835.22Rad4309-417 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007478	`PF01841.26`	Transglut_core	243	327	1.2e-17	64.9
LXL04_007478	`PF03835.22`	Rad4	309	417	9e-09	35.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGY9`	Arabidopsis thaliana	Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase	61.474%	Swiss-Prot	strong database homology
`Q7F0R1`	Oryza sativa subsp. japonica	Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase	56.659%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card