LXL04_007150 | RubberDandelionOmics

Gene overview

LXL04_007150

Reference: OH-1004 Chr: Chr02 Coordinates: 37495755-37502779 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3954 bp · LXL04_007150|LXL04_007150|OH1004|cDNA

ATGGGGGAAAGCAGTCGGAAGTATGAAGGCGTGAAAACAGAAGCCGAGATGTTACGGAATACACCGTCGAATCTAAGGAGGTTAGCTGACGAGATACAGCAGTGCGAGGGAAGACAGAAGTATCTTGCGCAGACTAGAAGCCCCTCGGATGGGGGCGATGTTAGATGGTACTATTCTAAGCTTCCAGTGGCGGAAAACGAGCTAGCTGCTGCTGTCCCACCTACAGAAGTAGTAGGGAAAGGTGATTACTTCCGATTTGG...

CDS

Download CDS FASTA

3954 bp · LXL04_007150|LXL04_007150|OH1004|CDS

ATGGGGGAAAGCAGTCGGAAGTATGAAGGCGTGAAAACAGAAGCCGAGATGTTACGGAATACACCGTCGAATCTAAGGAGGTTAGCTGACGAGATACAGCAGTGCGAGGGAAGACAGAAGTATCTTGCGCAGACTAGAAGCCCCTCGGATGGGGGCGATGTTAGATGGTACTATTCTAAGCTTCCAGTGGCGGAAAACGAGCTAGCTGCTGCTGTCCCACCTACAGAAGTAGTAGGGAAAGGTGATTACTTCCGATTTGG...

Protein

Download Protein FASTA

1317 aa · LXL04_007150|LXL04_007150|OH1004|PROTEIN

MGESSRKYEGVKTEAEMLRNTPSNLRRLADEIQQCEGRQKYLAQTRSPSDGGDVRWYYSKLPVAENELAAAVPPTEVVGKGDYFRFGMRDSLAIEASFLQREEELLSNWWREYGECSEGPKGSLSSIPESDPDQKPYNAPTTQSSKLYTDEEERVGVPVKGGLYEVDLLRRHSFPVYWNGDNRRVLRGHGFAVKGSLDWLPLREDVAEQLEFAYRSKVWHRRTFQPSGLFAARVDMPGSSPGLHALFTGEDDTWEVWLHI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007150`
TK1151 ID	TkA03G127420
OH-1004 ID	LXL04_007150
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.000
Protein coverage (%)	TK1151 95.789 / OH-1004 27.639 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007150

Location Chr02:37495755-37502779 (+)

Description Similar to SGR2: Phospholipase SGR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31480`	Involved in vacuolar formation or function (e.g. formation of vacuolar membrane 'bulbs').	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007150 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009590 detection of gravity Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009630 gravitropism Biological Process

GO:0009660 amyloplast organization Biological Process

GO:0009959 negative gravitropism Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G31480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.447

Rank 1 · LXL04_007150 · OH-1004

Nucleus0.300

Rank 2 · LXL04_007150 · OH-1004

Cell membrane0.232

Rank 3 · LXL04_007150 · OH-1004

Endoplasmic reticulum0.090

Rank 4 · LXL04_007150 · OH-1004

Mitochondrion0.065

Rank 5 · LXL04_007150 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23463.2WWE_254-185 aa

PF00931.29NB-ARC339-491 aa

PF23282.2WHD_ROQ1560-632 aa

PF23463.2WWE_21040-1171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007150	`PF23463.2`	WWE_2	54	185	1.8e-12	48.8
LXL04_007150	`PF00931.29`	NB-ARC	339	491	6.8e-22	78.6
LXL04_007150	`PF23282.2`	WHD_ROQ1	560	632	7.3e-14	52.4
LXL04_007150	`PF23463.2`	WWE_2	1040	1171	1.8e-12	48.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W5R2`	Arabidopsis thaliana	Phospholipase SGR2	71.479%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card