LXL04_006202 | RubberDandelionOmics

Gene overview

LXL04_006202

Reference: OH-1004 Chr: Chr02 Coordinates: 3673278-3674759 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1482 bp · LXL04_006202|LXL04_006202|OH1004|cDNA

atgaACAAATCCGCCATGGGAGACCTTCTAGCTCAGCTAGGTTCAGTCCTCGCAAGCGTCATGTTCGTATGGGCAATCATTCAACAATACTTCCCTTACAACATCCGCAACTTCTTCGACAAATACTCCCAAAGATTCCTCACTTTATTCTACCCTTACATCCAAATCACGTTTAACGAGTTCACCGGCGAACGTTTCAAACGGAGTGAAGCCTACTCCGCCATCGAAACCTACCTCGGTACCACCTCCTCCATGCAAGC...

CDS

Download CDS FASTA

1482 bp · LXL04_006202|LXL04_006202|OH1004|CDS

ATGAACAAATCCGCCATGGGAGACCTTCTAGCTCAGCTAGGTTCAGTCCTCGCAAGCGTCATGTTCGTATGGGCAATCATTCAACAATACTTCCCTTACAACATCCGCAACTTCTTCGACAAATACTCCCAAAGATTCCTCACTTTATTCTACCCTTACATCCAAATCACGTTTAACGAGTTCACCGGCGAACGTTTCAAACGGAGTGAAGCCTACTCCGCCATCGAAACCTACCTCGGTACCACCTCCTCCATGCAAGC...

Protein

Download Protein FASTA

493 aa · LXL04_006202|LXL04_006202|OH1004|PROTEIN

MNKSAMGDLLAQLGSVLASVMFVWAIIQQYFPYNIRNFFDKYSQRFLTLFYPYIQITFNEFTGERFKRSEAYSAIETYLGTTSSMQAKRFKADIIKNNTQPLALSMDDHEEVADEFNGVKVYWASGKNILKSQSFSFYPNTDEKRYYKLTFHKRHRELIFGPYLNHVLKEGREIKVKNRLRKLYTNNGSQWSHVVFEHPASFQTLAMDPVKKQEIVDDLTTFSNAEEFYNRIGRAWKRGYLLYGPPGTGKSTMIAAMANF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006202`
TK1151 ID	TkAUNG076580
OH-1004 ID	LXL04_006202
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.200
Protein coverage (%)	TK1151 100.000 / OH-1004 58.215 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006202

Location Chr02:3673278-3674759 (-)

Description Similar to AATP1: AAA-ATPase ASD, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40010`	Required to regulate morphology and anatomy during seed maturation.	No verified direct reference in this release
`At3g28580`	AAA-ATPase At3g28580.	No verified direct reference in this release
`At3g28510`	AAA-ATPase At3g28510.	No verified direct reference in this release
`At3g28540`	AAA-ATPase At3g28540.	No verified direct reference in this release
`At3g28600`	AAA-ATPase At3g28600.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006202 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000304 response to singlet oxygen Biological Process

GO:0006950 response to stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010154 fruit development Biological Process

GO:0010431 seed maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G28510

ath:AT3G28540

ath:AT3G28580

ath:AT3G28600

ath:AT5G40010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.246

Rank 1 · LXL04_006202 · OH-1004

Cytoplasm0.208

Rank 2 · LXL04_006202 · OH-1004

Endoplasmic reticulum0.207

Rank 3 · LXL04_006202 · OH-1004

Nucleus0.195

Rank 4 · LXL04_006202 · OH-1004

Cell membrane0.102

Rank 5 · LXL04_006202 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14363.12AAA_assoc31-125 aa

PF00004.36AAA240-385 aa

PF25568.1AAA_lid_At3g28540387-460 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006202	`PF14363.12`	AAA_assoc	31	125	4.6e-25	88.6
LXL04_006202	`PF00004.36`	AAA	240	385	1.6e-17	64.9
LXL04_006202	`PF25568.1`	AAA_lid_At3g28540	387	460	2.9e-31	107.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLD5`	Arabidopsis thaliana	AAA-ATPase ASD, mitochondrial	61.135%	Swiss-Prot	strong database homology
`Q9LJJ7`	Arabidopsis thaliana	AAA-ATPase At3g28580	60.746%	Swiss-Prot	strong database homology
`Q9LH84`	Arabidopsis thaliana	AAA-ATPase At3g28510	55.652%	Swiss-Prot	strong database homology
`Q9LH82`	Arabidopsis thaliana	AAA-ATPase At3g28540	53.611%	Swiss-Prot	strong database homology
`F4J0C0`	Arabidopsis thaliana	AAA-ATPase At3g28600	51.828%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card