LXL04_005935 | RubberDandelionOmics

Gene overview

LXL04_005935

Reference: OH-1004 Chr: Chr01 Coordinates: 175906017-175908616 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1095 bp · LXL04_005935|LXL04_005935|OH1004|cDNA

ATGGCTACTAGTAAAATCCGGACAAGTAGTTTCTCAAGGAACATTGCAACTGCACCCCCATCTTCGGTCCCTGGACTCAAGTACGGACCAAATGGCACAATATTTCTCTCCTCAGGCATACCAGATCTTGACAAGATTTTAGGCGGAGGCTTCCATTTAGGAAGTCTGGTGATGATCATGGAAGACACAGATGCACCTCACCATATGCTTCTGTTAAGAACTTTCATGTCTCAGGGACTTGTACACAACCAACCTGTTCT...

CDS

Download CDS FASTA

1095 bp · LXL04_005935|LXL04_005935|OH1004|CDS

ATGGCTACTAGTAAAATCCGGACAAGTAGTTTCTCAAGGAACATTGCAACTGCACCCCCATCTTCGGTCCCTGGACTCAAGTACGGACCAAATGGCACAATATTTCTCTCCTCAGGCATACCAGATCTTGACAAGATTTTAGGCGGAGGCTTCCATTTAGGAAGTCTGGTGATGATCATGGAAGACACAGATGCACCTCACCATATGCTTCTGTTAAGAACTTTCATGTCTCAGGGACTTGTACACAACCAACCTGTTCT...

Protein

Download Protein FASTA

364 aa · LXL04_005935|LXL04_005935|OH1004|PROTEIN

MATSKIRTSSFSRNIATAPPSSVPGLKYGPNGTIFLSSGIPDLDKILGGGFHLGSLVMIMEDTDAPHHMLLLRTFMSQGLVHNQPVLYASPVKNPRAFLGTLPTTFVPKDDNKSRNTDEQQKDLRIAWQYKKYLGENKQEERDGKMEYCNDFDLRKPIEKHLIMGNRVECVSLLDCSNLDGFRDISSKFISQFPRYDGNITSAGRIAIQSFCAPQCDYYDKEWEMLSFIRSLKSMVRSSNTVAFLTFPPSLLSSSVSKRL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005935`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005935

Location Chr01:175906017-175908616 (+)

Description Similar to ELP4: Elongator complex protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11220`	Component of the elongator complex which is required for multiple tRNA modifications, including mcm5U (5-methoxycarbonylmethyl uridine), mcm5s2U (5-methoxycarbonylmethyl-2-thiouridine), and ncm5U (5-carbamoylmethyl uridine) (By similarity).	The elongata mutants identify a functional Elongator complex in plants with a role in cell proliferation during organ growth.2005 · DOI: 10.1073/pnas.0502600102 Cytological investigations of the Arabidopsis thaliana elo1 mutant give new insights into leaf lateral growth and Elongator function.2007 · DOI: 10.1093/aob/mcm102 Elongator mediates ABA responses, oxidative stress resistance and anthocyanin biosynthesis in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03931.x Plant Elongator regulates auxin-related genes during RNA polymerase II transcription elongation.2010 · DOI: 10.1073/pnas.0913559107

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005935 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002098 tRNA wobble uridine modification Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010928 regulation of auxin mediated signaling pathway Biological Process

GO:0031538 negative regulation of anthocyanin metabolic process Biological Process

GO:0035265 organ growth Biological Process

GO:0043609 regulation of carbon utilization Biological Process

GO:0051301 cell division Biological Process

KEGG gene cross-reference

ath:AT3G11220

bta:614139

ddi:DDB_G0278783

mmu:77766

xla:495207

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.616

Rank 1 · LXL04_005935 · OH-1004

Nucleus0.424

Rank 2 · LXL04_005935 · OH-1004

Lysosome / Vacuole0.069

Rank 3 · LXL04_005935 · OH-1004

Golgi apparatus0.058

Rank 4 · LXL04_005935 · OH-1004

Mitochondrion0.055

Rank 5 · LXL04_005935 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05625.18PAXNEB21-357 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005935	`PF05625.18`	PAXNEB	21	357	7e-85	286.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C778`	Arabidopsis thaliana	Elongator complex protein 4	62.192%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card