LXL04_004227 | RubberDandelionOmics

Gene overview

LXL04_004227

Reference: OH-1004 Chr: Chr01 Coordinates: 130239522-130242104 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2583 bp · LXL04_004227|LXL04_004227|OH1004|cDNA

ATGGCCGCAGTAACCACACCACTGTCAATATTATCAATCTTCATCATACTTAATTCCCTTCCAATCCCATCATTTTCTTGTCCGATTCATCAAAAACAAGCTCTTCTTCGTTTCAAATCCACCATCACCACCATCTTCAATTCCAACACCGATCCCAACTCCGATGATTTCACTCCATACGAAGAACTAGATTCATGGAGTCCCAAATCCGATTGTTGTTCCTGGGCCCGCGTAAATTGCAGCACAACCAGAAAGAAAAC...

CDS

Download CDS FASTA

2583 bp · LXL04_004227|LXL04_004227|OH1004|CDS

ATGGCCGCAGTAACCACACCACTGTCAATATTATCAATCTTCATCATACTTAATTCCCTTCCAATCCCATCATTTTCTTGTCCGATTCATCAAAAACAAGCTCTTCTTCGTTTCAAATCCACCATCACCACCATCTTCAATTCCAACACCGATCCCAACTCCGATGATTTCACTCCATACGAAGAACTAGATTCATGGAGTCCCAAATCCGATTGTTGTTCCTGGGCCCGCGTAAATTGCAGCACAACCAGAAAGAAAAC...

Protein

Download Protein FASTA

860 aa · LXL04_004227|LXL04_004227|OH1004|PROTEIN

MAAVTTPLSILSIFIILNSLPIPSFSCPIHQKQALLRFKSTITTIFNSNTDPNSDDFTPYEELDSWSPKSDCCSWARVNCSTTRKKTRIVTELHLGAVVPLFVDLVPVFSNVLNPLFEIRSLKLLDISMNSLVGEIPGDGFGNLTGLVHLDMMQNSFNGSIPGQLFRLPNLSYLDMSTNSLEGELGSELSSLRNLTTLTLSVNHFQGMIPPSLFKLESLRFLDLSNNSLTGGLSSEVGNLRNLESLKLNENFLTGTIPEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004227`
TK1151 ID	TkA01G178110
OH-1004 ID	LXL04_004227
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.800
Protein coverage (%)	TK1151 88.385 / OH-1004 58.140 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004227

Location Chr01:130239522-130242104 (+)

Description Similar to RLP46: Receptor-like protein 46

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04220`	Receptor-like protein 46.	No verified direct reference in this release
`At3g05660`	Receptor-like protein 33.	No verified direct reference in this release
`At5g25910`	Required for defense against powdery mildew pathogen.	No verified direct reference in this release
`At1g71400`	Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.	Functional analyses of the CLAVATA2-like proteins and their domains that contribute to CLAVATA2 specificity.2010 · DOI: 10.1104/pp.109.148197
`At5g46330`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004227 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006898 receptor-mediated endocytosis Biological Process

GO:0007165 signal transduction Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010200 response to chitin Biological Process

GO:0016045 detection of bacterium Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0052544 defense response by callose deposition in cell wall Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005768 endosome Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G71400

ath:AT3G05660

ath:AT4G04220

ath:AT5G25910

ath:AT5G46330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.838

Rank 1 · LXL04_004227 · OH-1004

Endoplasmic reticulum0.088

Rank 2 · LXL04_004227 · OH-1004

Cytoplasm0.057

Rank 3 · LXL04_004227 · OH-1004

Nucleus0.037

Rank 4 · LXL04_004227 · OH-1004

Extracellular0.029

Rank 5 · LXL04_004227 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_8120-181 aa

PF13855.13LRR_8190-229 aa

PF23598.2LRR_14213-297 aa

PF12799.14LRR_4218-253 aa

PF12799.14LRR_4242-277 aa

PF12799.14LRR_4265-301 aa

PF13855.13LRR_8282-325 aa

PF23598.2LRR_14304-366 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004227	`PF13855.13`	LRR_8	120	181	1.8e-54	182.1
LXL04_004227	`PF13855.13`	LRR_8	190	229	1.8e-54	182.1
LXL04_004227	`PF23598.2`	LRR_14	213	297	2.9e-44	152.0
LXL04_004227	`PF12799.14`	LRR_4	218	253	1.7e-44	149.5
LXL04_004227	`PF12799.14`	LRR_4	242	277	1.7e-44	149.5
LXL04_004227	`PF12799.14`	LRR_4	265	301	1.7e-44	149.5
LXL04_004227	`PF13855.13`	LRR_8	282	325	1.8e-54	182.1
LXL04_004227	`PF23598.2`	LRR_14	304	366	2.9e-44	152.0
LXL04_004227	`PF25013.1`	LRR_Zer-1	571	692	8.9e-16	59.0
LXL04_004227	`PF13855.13`	LRR_8	577	636	1.8e-54	182.1
LXL04_004227	`PF12799.14`	LRR_4	601	641	1.7e-44	149.5
LXL04_004227	`PF23598.2`	LRR_14	706	792	2.9e-44	152.0
LXL04_004227	`PF13855.13`	LRR_8	714	773	1.8e-54	182.1
LXL04_004227	`PF12799.14`	LRR_4	739	774	1.7e-44	149.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JGB6`	Arabidopsis thaliana	Receptor-like protein 46	44.549%	Swiss-Prot	moderate database homology
`F4J8G2`	Arabidopsis thaliana	Receptor-like protein 33	33.333%	Swiss-Prot	moderate database homology
`Q7FZR1`	Arabidopsis thaliana	Receptor-like protein 52	33.098%	Swiss-Prot	moderate database homology
`Q9C9H7`	Arabidopsis thaliana	Receptor-like protein 12	33.018%	Swiss-Prot	moderate database homology
`Q9FL28`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase FLS2	33.333%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card