LXL04_002715 | RubberDandelionOmics

Gene overview

LXL04_002715

Reference: OH-1004 Chr: Chr01 Coordinates: 55804844-55805557 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

714 bp · LXL04_002715|LXL04_002715|OH1004|cDNA

ATGGCTATTTTAACCACTGCTTTTCTCGTCTTTCTTTTCGTAATTGGCCTCGTTTCGACACTTTCAAGAATACCCGCAAAGAAATTCGCATCTCTGTTTCAATTTCAGCCGTCCTCCAATCAAGATCCAGTCAAGAATGAAAACATCGAACAACAGGAGAACAggaacaagaaaaagaaaaagaacatGACGATGGTGATGGAGAAAAAGATGAGTTTTGGTAGGGAAAGAACAGCAGAATTGAAGAGCGTTTTCGCGAC...

CDS

Download CDS FASTA

714 bp · LXL04_002715|LXL04_002715|OH1004|CDS

ATGGCTATTTTAACCACTGCTTTTCTCGTCTTTCTTTTCGTAATTGGCCTCGTTTCGACACTTTCAAGAATACCCGCAAAGAAATTCGCATCTCTGTTTCAATTTCAGCCGTCCTCCAATCAAGATCCAGTCAAGAATGAAAACATCGAACAACAGGAGAACAGGAACAAGAAAAAGAAAAAGAACATGACGATGGTGATGGAGAAAAAGATGAGTTTTGGTAGGGAAAGAACAGCAGAATTGAAGAGCGTTTTCGCGAC...

Protein

Download Protein FASTA

237 aa · LXL04_002715|LXL04_002715|OH1004|PROTEIN

MAILTTAFLVFLFVIGLVSTLSRIPAKKFASLFQFQPSSNQDPVKNENIEQQENRNKKKKKNMTMVMEKKMSFGRERTAELKSVFATFDKNKDGFITKQELSDSLKNIGISTSEKDVLEMVQRVDVNGDGLIDFDEFCELFESMMSREDEEGSKIDVGDREDGDLKEAFDVFDGDKNGLISVQELGLVLDSLGFKEGKTLEACKDMISKVDIDGDGMINFQEFKNMMKNGVSLISVS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002715`
TK1151 ID	TkA01G425900
OH-1004 ID	LXL04_002715
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 46.418 / OH-1004 68.354 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002715

Location Chr01:55804844-55805557 (-)

Description Similar to CML4: Calmodulin-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59440`	Potential calcium sensor.	No verified direct reference in this release
`At2g43290`	Potential calcium sensor.	No verified direct reference in this release
`At3g07490`	Potential calcium sensor.	No verified direct reference in this release
`At1g05990`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0492800`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002715 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G05990

ath:AT2G43290

ath:AT3G07490

ath:AT3G59440

dosa:Os04g0492800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.384

Rank 1 · LXL04_002715 · OH-1004

Nucleus0.236

Rank 2 · LXL04_002715 · OH-1004

Cytoplasm0.195

Rank 3 · LXL04_002715 · OH-1004

Mitochondrion0.094

Rank 4 · LXL04_002715 · OH-1004

Cell membrane0.094

Rank 5 · LXL04_002715 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10591.16SPARC_Ca_bdg50-139 aa

PF25825.2SAPC2_N79-147 aa

PF00036.39EF-hand_180-106 aa

PF13499.13EF-hand_780-141 aa

PF13405.13EF-hand_680-109 aa

PF24548.2EF_EFCAB10_C80-119 aa

PF13202.13EF-hand_581-102 aa

PF14658.13EF-hand_982-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002715	`PF10591.16`	SPARC_Ca_bdg	50	139	9.9e-09	36.2
LXL04_002715	`PF25825.2`	SAPC2_N	79	147	7.1e-08	32.9
LXL04_002715	`PF00036.39`	EF-hand_1	80	106	1.8e-30	102.9
LXL04_002715	`PF13499.13`	EF-hand_7	80	141	9.2e-30	103.5
LXL04_002715	`PF13405.13`	EF-hand_6	80	109	7.7e-25	84.9
LXL04_002715	`PF24548.2`	EF_EFCAB10_C	80	119	2.4e-08	34.2
LXL04_002715	`PF13202.13`	EF-hand_5	81	102	8.7e-22	76.3
LXL04_002715	`PF14658.13`	EF-hand_9	82	140	4.4e-11	43.8
LXL04_002715	`PF13833.13`	EF-hand_8	93	142	3.4e-12	46.6
LXL04_002715	`PF00036.39`	EF-hand_1	117	144	1.8e-30	102.9
LXL04_002715	`PF00036.39`	EF-hand_1	164	190	1.8e-30	102.9
LXL04_002715	`PF13499.13`	EF-hand_7	164	228	9.2e-30	103.5
LXL04_002715	`PF13405.13`	EF-hand_6	164	193	7.7e-25	84.9
LXL04_002715	`PF13202.13`	EF-hand_5	165	187	8.7e-22	76.3
LXL04_002715	`PF13833.13`	EF-hand_8	202	229	3.4e-12	46.6
LXL04_002715	`PF00036.39`	EF-hand_1	203	229	1.8e-30	102.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX27`	Arabidopsis thaliana	Calmodulin-like protein 4	50.323%	Swiss-Prot	moderate database homology
`O22845`	Arabidopsis thaliana	Calmodulin-like protein 5	50.000%	Swiss-Prot	moderate database homology
`Q9SRR7`	Arabidopsis thaliana	Calmodulin-like protein 3	52.632%	Swiss-Prot	moderate database homology
`Q9LNE7`	Arabidopsis thaliana	Calmodulin-like protein 7	51.316%	Swiss-Prot	moderate database homology
`Q0JC44`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML22	47.742%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card