Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3660 bp · LXL04_001915|LXL04_001915|OH1004|cDNA
ATGGAGATCTCACCCAATTCGGATACCAAACTCCCTGTTCGTCGGCGATTGATTCAGTCGACACTAATCCCCCACAAGTCTCAAGACAATGCCGTCAGTGTAGACGAAGATCTCGAACCTGATGTAGACcaggaagatgatgatgaggagtATTGCGGGAGTCAGAGTCGAGCCAGGAAAAACAAAAAGCGAAAACCAAAATTAGTGTCTCAATCACGAGTTTCAACGAAGGTTGCTGTAAACGGGAATGAAACTGGAGC...
3660 bp · LXL04_001915|LXL04_001915|OH1004|CDS
ATGGAGATCTCACCCAATTCGGATACCAAACTCCCTGTTCGTCGGCGATTGATTCAGTCGACACTAATCCCCCACAAGTCTCAAGACAATGCCGTCAGTGTAGACGAAGATCTCGAACCTGATGTAGACCAGGAAGATGATGATGAGGAGTATTGCGGGAGTCAGAGTCGAGCCAGGAAAAACAAAAAGCGAAAACCAAAATTAGTGTCTCAATCACGAGTTTCAACGAAGGTTGCTGTAAACGGGAATGAAACTGGAGC...
Protein
Download Protein FASTA1219 aa · LXL04_001915|LXL04_001915|OH1004|PROTEIN
MEISPNSDTKLPVRRRLIQSTLIPHKSQDNAVSVDEDLEPDVDQEDDDEEYCGSQSRARKNKKRKPKLVSQSRVSTKVAVNGNETGAKNTEEEDSPATVKCDFFLKVSERRQLQKQKKEQLPIQSPDKNDQNQDLELDVDQEDDEDEEYSLSQSQAKKNKKRKPKAVSQSRPSRKLAVNKNEIEVKNAEEEDSPATVKCDFFLKVSERRNQRRPKKEHTPVKIEQSCSPSDAIANSKTPRKTRRRASSTPKKQTPSKNGV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_001915 |
|---|---|
| TK1151 ID | TkA01G498680 |
| OH-1004 ID | LXL04_001915 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.900 |
| Protein coverage (%) | TK1151 99.220 / OH-1004 83.511Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_001915 |
|---|---|
| Location | Chr01:36812301-36817687 (+) |
| Description | Similar to Atad5: ATPase family AAA domain-containing protein 5 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000278 mitotic cell cycle Biological Process GO:0006261 DNA-templated DNA replication Biological Process GO:0006272 leading strand elongation Biological Process GO:0006281 DNA repair Biological Process GO:0006298 mismatch repair Biological Process GO:0006974 DNA damage response Biological Process GO:0008283 cell population proliferation Biological Process GO:0033260 nuclear DNA replication Biological Process GO:0042770 signal transduction in response to DNA damage Biological Process GO:0045740 positive regulation of DNA replication Biological Process GO:0051301 cell division Biological Process GO:1901990 regulation of mitotic cell cycle phase transition Biological Process |
| KEGG gene cross-reference | hsa:79915 mmu:237877 sce:YOR217W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03215.22Rad17502-635 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_001915 | PF03215.22 | Rad17 | 502 | 635 | 4e-06 | 27.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.