LXL04_001302 | RubberDandelionOmics

Gene overview

LXL04_001302

Reference: OH-1004 Chr: Chr01 Coordinates: 23765796-23767295 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · LXL04_001302|LXL04_001302|OH1004|cDNA

ATGGGTGTAATGACGGCTGAGGCAGTCGTGGCACACTTCTCTTTTAAATTTCTATGGCGATTCTTCAGGCGAGCATGGTTCATGGATGATGTCCAGGGGGATCCACAGCTTCCTCATCATCGCAATCCTGATGAGTTCGTCTCCCCTGATCACTTAGCAGATTTGGGCGTTTTGCACTGGAAGTTAAATCCAGACAAGTACGAGGAGGATGAAGAACTAGAGAATATCAGGGCTACCAGAGGCTACAATTACATGGATCT...

CDS

Download CDS FASTA

624 bp · LXL04_001302|LXL04_001302|OH1004|CDS

ATGGGTGTAATGACGGCTGAGGCAGTCGTGGCACACTTCTCTTTTAAATTTCTATGGCGATTCTTCAGGCGAGCATGGTTCATGGATGATGTCCAGGGGGATCCACAGCTTCCTCATCATCGCAATCCTGATGAGTTCGTCTCCCCTGATCACTTAGCAGATTTGGGCGTTTTGCACTGGAAGTTAAATCCAGACAAGTACGAGGAGGATGAAGAACTAGAGAATATCAGGGCTACCAGAGGCTACAATTACATGGATCT...

Protein

Download Protein FASTA

207 aa · LXL04_001302|LXL04_001302|OH1004|PROTEIN

MGVMTAEAVVAHFSFKFLWRFFRRAWFMDDVQGDPQLPHHRNPDEFVSPDHLADLGVLHWKLNPDKYEEDEELENIRATRGYNYMDLLDLCPEKVENYEQKLKNFYTEHIHADEEIRYCLEGSGYFDVRDKDDRWIRIWIKAGDLIILPAGIYHRFTLDTSNYIKLMRLFVGEPVWTAFNRPQEEHPARRKYIVDFGQKIRMPLEAH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001302`
TK1151 ID	TkA01G548670
OH-1004 ID	LXL04_001302
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 97.872 / OH-1004 88.889 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001302

Location Chr01:23765796-23767295 (-)

Description Similar to VIT_05s0020g04070: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43850`	Catalyzes 2 different reactions between oxygen and the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene) depending upon the metal bound in the active site.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001302 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006555 methionine metabolic process Biological Process

GO:0019509 L-methionine salvage from methylthioadenosine Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0010308 acireductone dioxygenase (Ni2+-requiring) activity Molecular Function

GO:0010309 acireductone dioxygenase [iron(II)-requiring] activity Molecular Function

GO:0016151 nickel cation binding Molecular Function

KEGG gene cross-reference

ath:AT5G43850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.641

Rank 1 · LXL04_001302 · OH-1004

Nucleus0.404

Rank 2 · LXL04_001302 · OH-1004

Endoplasmic reticulum0.089

Rank 3 · LXL04_001302 · OH-1004

Mitochondrion0.088

Rank 4 · LXL04_001302 · OH-1004

Cell membrane0.076

Rank 5 · LXL04_001302 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03079.21ARD24-178 aa

PF02311.26AraC_binding105-178 aa

PF07883.18Cupin_2108-162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001302	`PF03079.21`	ARD	24	178	3.2e-60	203.6
LXL04_001302	`PF02311.26`	AraC_binding	105	178	1.2e-06	29.1
LXL04_001302	`PF07883.18`	Cupin_2	108	162	3e-09	37.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H185`	Arabidopsis thaliana	Acireductone dioxygenase 4	75.410%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card