LXL04_001069 | RubberDandelionOmics

Gene overview

LXL04_001069

Reference: OH-1004 Chr: Chr01 Coordinates: 19674373-19675772 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

570 bp · LXL04_001069|LXL04_001069|OH1004|cDNA

atggcGGAGCTTACTGTGATTCTGTACATGCTTACAATTTCTCTGTTTACGGCCACCTCCTCCGCATCGCAGTGTTCTACCAACGGTATTCCCTTGGTGAGAAATATCAATGAGCTACCACAAGATAACTATGGAAGGCCTGGGCTGTCTCACATTACTGTTGCAGGTTCTCTTATGCATGGGCTGAAAGAGGTTGAGATATGGCTTCAGACATTTGCTCCAGGAACACACACTCCAATTCACAGACACTCATGTGAGGA...

CDS

Download CDS FASTA

570 bp · LXL04_001069|LXL04_001069|OH1004|CDS

ATGGCGGAGCTTACTGTGATTCTGTACATGCTTACAATTTCTCTGTTTACGGCCACCTCCTCCGCATCGCAGTGTTCTACCAACGGTATTCCCTTGGTGAGAAATATCAATGAGCTACCACAAGATAACTATGGAAGGCCTGGGCTGTCTCACATTACTGTTGCAGGTTCTCTTATGCATGGGCTGAAAGAGGTTGAGATATGGCTTCAGACATTTGCTCCAGGAACACACACTCCAATTCACAGACACTCATGTGAGGA...

Protein

Download Protein FASTA

189 aa · LXL04_001069|LXL04_001069|OH1004|PROTEIN

MAELTVILYMLTISLFTATSSASQCSTNGIPLVRNINELPQDNYGRPGLSHITVAGSLMHGLKEVEIWLQTFAPGTHTPIHRHSCEEVFIVLKGSGTLYLSSNSHSKSPGKPEEFSVSSNTTFYIPVNDVHQLWNTNDKEDLQVLVVISRPPVKIFMYDDWLMPHTAAKLKFPYYWDEQCYQTNSKDEL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001069`
TK1151 ID	TkA01G563410
OH-1004 ID	LXL04_001069
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001069

Location Chr01:19674373-19675772 (+)

Description Similar to T85: Auxin-binding protein T85

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02980`	Auxin receptor that controls cell elongation and cell division.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001069 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010928 regulation of auxin mediated signaling pathway Biological Process

GO:0032877 positive regulation of DNA endoreduplication Biological Process

GO:0045793 positive regulation of cell size Biological Process

GO:0051781 positive regulation of cell division Biological Process

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G02980

zma:542294

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.359

Rank 1 · LXL04_001069 · OH-1004

Golgi apparatus0.265

Rank 2 · LXL04_001069 · OH-1004

Endoplasmic reticulum0.228

Rank 3 · LXL04_001069 · OH-1004

Cytoplasm0.122

Rank 4 · LXL04_001069 · OH-1004

Cell membrane0.080

Rank 5 · LXL04_001069 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02041.23Auxin_BP22-189 aa

PF00190.29Cupin_162-155 aa

PF07883.18Cupin_268-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001069	`PF02041.23`	Auxin_BP	22	189	3.3e-94	313.9
LXL04_001069	`PF00190.29`	Cupin_1	62	155	1e-05	25.8
LXL04_001069	`PF07883.18`	Cupin_2	68	147	6.1e-11	42.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P33487`	Arabidopsis thaliana	Auxin-binding protein 1	67.204%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card