LXL04_000567 | RubberDandelionOmics

Gene overview

LXL04_000567

Reference: OH-1004 Chr: Chr01 Coordinates: 10386252-10387109 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

434 bp · LXL04_000567|LXL04_000567|OH1004|cDNA

ATTTATCATCTCTGATAGTCATTTCGTTGCAGTAGATTACAGATAAGATGAACAACGCTTCAGCTGGAGCCTCATCAAAAGCAAGAGTTGGTTCATCCCAACCATCAGAAACATCCTTCAAGCGCAAACGTGGAGTTTTTCAGAAAGATCTACAGCATATGATGTATGGATTCGGAGATGATCCTAATCCATTACCAGAGACTGTTGCTCTTGTGGAAGACATTGTTGTTGAGTATGTGACAGATATGGTGCATAAAGCC...

CDS

Download CDS FASTA

387 bp · LXL04_000567|LXL04_000567|OH1004|CDS

ATGAACAACGCTTCAGCTGGAGCCTCATCAAAAGCAAGAGTTGGTTCATCCCAACCATCAGAAACATCCTTCAAGCGCAAACGTGGAGTTTTTCAGAAAGATCTACAGCATATGATGTATGGATTCGGAGATGATCCTAATCCATTACCAGAGACTGTTGCTCTTGTGGAAGACATTGTTGTTGAGTATGTGACAGATATGGTGCATAAAGCCCAAGATATTGCATCAAAGAGAGGAAAGCTTTTAACCGAGGATTTCTT...

Protein

Download Protein FASTA

128 aa · LXL04_000567|LXL04_000567|OH1004|PROTEIN

MNNASAGASSKARVGSSQPSETSFKRKRGVFQKDLQHMMYGFGDDPNPLPETVALVEDIVVEYVTDMVHKAQDIASKRGKLLTEDFLFLIRKDTPKLNRCTELLSMNEELKQARKAFDVDEEKLATVD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000567`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000567

Location Chr01:10386252-10387109 (-)

Description Similar to TAF13: Transcription initiation factor TFIID subunit 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02680`	TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription.	TAF13 interacts with PRC2 members and is essential for Arabidopsis seed development.2013 · DOI: 10.1016/j.ydbio.2013.03.005

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000567 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006352 DNA-templated transcription initiation Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009960 endosperm development Biological Process

GO:0042789 mRNA transcription by RNA polymerase II Biological Process

GO:0048316 seed development Biological Process

GO:0051123 RNA polymerase II preinitiation complex assembly Biological Process

GO:0060261 positive regulation of transcription initiation by RNA polymerase II Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005669 transcription factor TFIID complex Cellular Component

KEGG gene cross-reference

ath:AT1G02680

ddi:DDB_G0292838

hsa:6884

mmu:99730

pon:100172778

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.955

Rank 1 · LXL04_000567 · OH-1004

Cytoplasm0.177

Rank 2 · LXL04_000567 · OH-1004

Mitochondrion0.017

Rank 3 · LXL04_000567 · OH-1004

Cell membrane0.016

Rank 4 · LXL04_000567 · OH-1004

Endoplasmic reticulum0.010

Rank 5 · LXL04_000567 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02269.23TFIID-18kDa30-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000567	`PF02269.23`	TFIID-18kDa	30	118	2.5e-32	111.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NQH4`	Arabidopsis thaliana	Transcription initiation factor TFIID subunit 13	72.973%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card