LXL04_000301 | RubberDandelionOmics

Gene overview

LXL04_000301

Reference: OH-1004 Chr: Chr01 Coordinates: 5635196-5636101 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

804 bp · LXL04_000301|LXL04_000301|OH1004|cDNA

ATGGAGCGTATATGTGGTCGGGCATTGGGCTTACAATTTGACAAAAATACGGGATCATTATTCATTGCAGATGCTTATTTTGGGCTACTTTCAGTGGGCCCTAAAGGTGGGTTAGCCACTTCTCTGGTATCAAAAGACCAGAATCTTCCATTAAAATTCACAAATTCACTAGACATTGACCAGACCAATAGAGTCATCTACTTTACCGATAGCAGTCAACGTTACACCCGTAGGGATCACATGCTTGTCATACTCACAAA...

CDS

Download CDS FASTA

804 bp · LXL04_000301|LXL04_000301|OH1004|CDS

ATGGAGCGTATATGTGGTCGGGCATTGGGCTTACAATTTGACAAAAATACGGGATCATTATTCATTGCAGATGCTTATTTTGGGCTACTTTCAGTGGGCCCTAAAGGTGGGTTAGCCACTTCTCTGGTATCAAAAGACCAGAATCTTCCATTAAAATTCACAAATTCACTAGACATTGACCAGACCAATAGAGTCATCTACTTTACCGATAGCAGTCAACGTTACACCCGTAGGGATCACATGCTTGTCATACTCACAAA...

Protein

Download Protein FASTA

267 aa · LXL04_000301|LXL04_000301|OH1004|PROTEIN

MERICGRALGLQFDKNTGSLFIADAYFGLLSVGPKGGLATSLVSKDQNLPLKFTNSLDIDQTNRVIYFTDSSQRYTRRDHMLVILTNEKTGRLLKYDLESTNVTVIHNNLTFPNGVTLSQDGNFLLVAETTSCRIMRFWLKTPKAGTCEVFADLPGYPDNIKRNQQGEFWVAMYSRKSKILRWFHSKPWIVYVLSKVIPINIIRVTSHIGKGKGEGLAVKLGVNGEILEILEDVHGKRWKYASEVMERDGNLWIGSVENN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000301`
TK1151 ID	TkA01G621610
OH-1004 ID	LXL04_000301
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000301

Location Chr01:5635196-5636101 (-)

Description Similar to SSL10: Protein STRICTOSIDINE SYNTHASE-LIKE 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57030`	Protein STRICTOSIDINE SYNTHASE-LIKE 10.	No verified direct reference in this release
`At2g41290`	Protein STRICTOSIDINE SYNTHASE-LIKE 2.	No verified direct reference in this release
`At2g41300`	Protein STRICTOSIDINE SYNTHASE-LIKE 1.	No verified direct reference in this release
`At1g08470`	Protein STRICTOSIDINE SYNTHASE-LIKE 3.	No verified direct reference in this release
`At3g59530`	Required for the exine formation during pollen development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000301 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G08470

ath:AT2G41290

ath:AT2G41300

ath:AT3G57030

ath:AT3G59530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.398

Rank 1 · LXL04_000301 · OH-1004

Lysosome / Vacuole0.236

Rank 2 · LXL04_000301 · OH-1004

Cytoplasm0.165

Rank 3 · LXL04_000301 · OH-1004

Extracellular0.134

Rank 4 · LXL04_000301 · OH-1004

Cell membrane0.117

Rank 5 · LXL04_000301 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03088.23Str_synth55-142 aa

PF08450.19SGL87-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000301	`PF03088.23`	Str_synth	55	142	2.9e-30	104.9
LXL04_000301	`PF08450.19`	SGL	87	182	2.3e-15	57.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4V3D9`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 10	51.362%	Swiss-Prot	strong database homology
`Q9SLG8`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 2	46.520%	Swiss-Prot	moderate database homology
`F4IJZ6`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 1	44.961%	Swiss-Prot	moderate database homology
`Q8VWF6`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 3	45.914%	Swiss-Prot	moderate database homology
`Q9M1B4`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 13	42.692%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card