LXL04_000189 | RubberDandelionOmics

Gene overview

LXL04_000189

Reference: OH-1004 Chr: Chr01 Coordinates: 3842873-3846873 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2394 bp · LXL04_000189|LXL04_000189|OH1004|cDNA

ATGATCATCACACGCATATCACGATATCTCTCCCGTTCCTCTCACTCTACGTTCCAACGAAATGTGAGGGGATTGATTTCAAGGGAATCATCAACAAATGCGAGCATCGCACGCTTAGAGGGCGGAGCAGGGCTCGTGAGGACCTACTTAACCTCAGTTTGTGCTAAGGGGCCGATTATTAACCCTAAAAATCTAGCAAAAAACCTAGGGCTACGAAGGCTGTTCTGCAGCGAGGCACCAAAGAGAAAACACTATGAAAA...

CDS

Download CDS FASTA

2394 bp · LXL04_000189|LXL04_000189|OH1004|CDS

ATGATCATCACACGCATATCACGATATCTCTCCCGTTCCTCTCACTCTACGTTCCAACGAAATGTGAGGGGATTGATTTCAAGGGAATCATCAACAAATGCGAGCATCGCACGCTTAGAGGGCGGAGCAGGGCTCGTGAGGACCTACTTAACCTCAGTTTGTGCTAAGGGGCCGATTATTAACCCTAAAAATCTAGCAAAAAACCTAGGGCTACGAAGGCTGTTCTGCAGCGAGGCACCAAAGAGAAAACACTATGAAAA...

Protein

Download Protein FASTA

797 aa · LXL04_000189|LXL04_000189|OH1004|PROTEIN

MIITRISRYLSRSSHSTFQRNVRGLISRESSTNASIARLEGGAGLVRTYLTSVCAKGPIINPKNLAKNLGLRRLFCSEAPKRKHYENYYPKGKREVPKGEGQKSGSKGDSGKNDNRENLMKQYQTLISPLMFFAFVLSSIFLTPQEQKQISFQEFKNKLLEPGLVDHIVVTNKSVAKVYVKPSLPHRIQVNEEPVQGGNVGSRGDVSHYEYYFNIGSVETFEEKLEEAQEALGIDPHNYVPVTYSSETNWGQELIRLTPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000189`
TK1151 ID	TkA01G628460
OH-1004 ID	LXL04_000189
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000189

Location Chr01:3842873-3846873 (-)

Description Similar to FTSH8: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07510`	Probable ATP-dependent zinc metallopeptidase.	No verified direct reference in this release
`At2g29080`	Probable ATP-dependent zinc metallopeptidase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0458400`	Probable ATP-dependent zinc metallopeptidase.	No verified direct reference in this release
`Os01g0842600`	Probable ATP-dependent zinc metallopeptidase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000189 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0016485 protein processing Biological Process

GO:0016540 protein autoprocessing Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0033619 membrane protein proteolysis Biological Process

GO:0034982 mitochondrial protein processing Biological Process

GO:0036444 calcium import into the mitochondrion Biological Process

GO:0051560 mitochondrial calcium ion homeostasis Biological Process

GO:0051604 protein maturation Biological Process

GO:0072753 cellular response to glutathione Biological Process

GO:0110097 regulation of calcium import into the mitochondrion Biological Process

GO:0141164 mitochondrial protein quality control Biological Process

KEGG gene cross-reference

ath:AT1G07510

ath:AT2G29080

dosa:Os01g0842600

dosa:Os05g0458400

hsa:10939

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.923

Rank 1 · LXL04_000189 · OH-1004

Cytoplasm0.065

Rank 2 · LXL04_000189 · OH-1004

Nucleus0.051

Rank 3 · LXL04_000189 · OH-1004

Plastid0.035

Rank 4 · LXL04_000189 · OH-1004

Cell membrane0.029

Rank 5 · LXL04_000189 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06480.21FtsH_ext131-238 aa

PF00004.36AAA371-503 aa

PF17862.8AAA_lid_3534-573 aa

PF01434.25Peptidase_M41588-769 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000189	`PF06480.21`	FtsH_ext	131	238	4.1e-10	40.5
LXL04_000189	`PF00004.36`	AAA	371	503	1e-42	146.4
LXL04_000189	`PF17862.8`	AAA_lid_3	534	573	2.1e-12	47.1
LXL04_000189	`PF01434.25`	Peptidase_M41	588	769	1.1e-64	218.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZI8`	Arabidopsis thaliana	ATP-dependent zinc metalloprotease FTSH 10, mitochondrial	68.434%	Swiss-Prot	strong database homology
`Q84WU8`	Arabidopsis thaliana	ATP-dependent zinc metalloprotease FTSH 3, mitochondrial	67.822%	Swiss-Prot	strong database homology
`Q0DHL4`	Oryza sativa subsp. japonica	ATP-dependent zinc metalloprotease FTSH 8, mitochondrial	72.418%	Swiss-Prot	strong database homology
`Q8S2A7`	Oryza sativa subsp. japonica	ATP-dependent zinc metalloprotease FTSH 3, mitochondrial	67.248%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card