TkAUNG067140 | RubberDandelionOmics

Gene overview

TkAUNG067140

Reference: TK1151 Chr: ChrUn Coordinates: 19500670-19501427 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

639 bp · TkAUNG067140|TK1151|cDNA

ATGATGGGTTTTCGACTGGATGAAGCTACATTGGATGATTTGCTTGTCCCTTGTCATGGAAGAAAGGCTAGTGCATATGATGTGGATTTGATCCTTAGGTTCTTGAAAATATTTCTAGGCGAACAAATAAACGTGTTGTTCATGAAACGTTTGAAGAAAGTCGGGTTTTTGATTGATTTGTACCTTAATGAAGTTGCCCCTGATCCTTGTCTTAAGCCTAGCAAGTTTCTGCACTATCCCTTTGCTTACCAGATTCAGCA...

CDS

Download CDS FASTA

639 bp · TkAUNG067140|TK1151|CDS

ATGATGGGTTTTCGACTGGATGAAGCTACATTGGATGATTTGCTTGTCCCTTGTCATGGAAGAAAGGCTAGTGCATATGATGTGGATTTGATCCTTAGGTTCTTGAAAATATTTCTAGGCGAACAAATAAACGTGTTGTTCATGAAACGTTTGAAGAAAGTCGGGTTTTTGATTGATTTGTACCTTAATGAAGTTGCCCCTGATCCTTGTCTTAAGCCTAGCAAGTTTCTGCACTATCCCTTTGCTTACCAGATTCAGCA...

Protein

Download Protein FASTA

212 aa · TkAUNG067140|TK1151|PROTEIN

MMGFRLDEATLDDLLVPCHGRKASAYDVDLILRFLKIFLGEQINVLFMKRLKKVGFLIDLYLNEVAPDPCLKPSKFLHYPFAYQIQQESLVTEFVHKDMSEEEKIRMCSVLNYEKLSLESLMNLAENYTDFPACVADAALVVLQFKLKVCGKTKKTLEFRRNSSFSEGEDGHFLLQLSYGKECKKVKKNYANVARVSVTCPRSGKALPILCS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG067140`
TK1151 ID	TkAUNG067140
OH-1004 ID	LXL04_019818
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	42.400
Protein coverage (%)	TK1151 69.811 / OH-1004 29.020 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG067140

Location ChrUn:19500670-19501427 (+)

Description Similar to At3g22104: BTB/POZ domain-containing protein At3g22104

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22104`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g19850`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g50280`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g50840`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g08570`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019818 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009737 response to abscisic acid Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0031463 Cul3-RING ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT1G50280

ath:AT3G08570

ath:AT3G19850

ath:AT3G22104

ath:AT3G50840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.433

Rank 1 · TkAUNG067140 · TK1151

Nucleus0.415

Rank 2 · TkAUNG067140 · TK1151

Mitochondrion0.168

Rank 3 · TkAUNG067140 · TK1151

Cell membrane0.072

Rank 4 · TkAUNG067140 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkAUNG067140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03000NPH32-77 aa

PF03000NPH395-119 aa

PF04475DUF555130-150 aa

PF04475DUF555180-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG067140	`PF03000`	NPH3	2	77	1.3e-20	74.9
TkAUNG067140	`PF03000`	NPH3	95	119	1.3e-20	74.9
TkAUNG067140	`PF04475`	DUF555	130	150	0.17	12.8
TkAUNG067140	`PF04475`	DUF555	180	207	0.17	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5J4`	Arabidopsis thaliana	sp\|Q9C5J4\|Y3210_ARATH BTB/POZ domain-containing protein At3g22104	42.600%	Swiss-Prot	Medium
`Q9LT24`	Arabidopsis thaliana	sp\|Q9LT24\|Y3985_ARATH BTB/POZ domain-containing protein At3g19850	38.000%	Swiss-Prot	Medium
`Q8RXR6`	Arabidopsis thaliana	sp\|Q8RXR6\|Y1028_ARATH BTB/POZ domain-containing protein At1g50280	31.500%	Swiss-Prot	Medium
`Q8LPQ3`	Arabidopsis thaliana	sp\|Q8LPQ3\|Y3084_ARATH BTB/POZ domain-containing protein At3g50840	36.000%	Swiss-Prot	Medium
`Q9C9Z7`	Arabidopsis thaliana	sp\|Q9C9Z7\|Y3857_ARATH BTB/POZ domain-containing protein At3g08570	31.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card