LXL04_019818 | RubberDandelionOmics

Gene overview

LXL04_019818

Reference: OH-1004 Chr: Chr04 Coordinates: 40896777-40899779 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1626 bp · LXL04_019818|LXL04_019818|OH1004|cDNA

ATGGACGCTTCTTGTGATCTTGAAGTGGATGTTAATGGAGAAGAAACCTTCTTTGTTCATGAGAAAGTCGTCTCATCATATTGTGGAAAACTCAGAAAATTATTGGGAAAATCAAAATACCCACCAAAAAATCTCAAAGTTATATTTAACGATTTCCCCGGAGGACCCGAAAGTTTCGAGCTTATTTCAAGATTTTGCTACAACAATGGCAAAATCGTAATAAACCCCTACACCGCCCCTCGTCTTTTTTGTACCGCACA...

CDS

Download CDS FASTA

1626 bp · LXL04_019818|LXL04_019818|OH1004|CDS

ATGGACGCTTCTTGTGATCTTGAAGTGGATGTTAATGGAGAAGAAACCTTCTTTGTTCATGAGAAAGTCGTCTCATCATATTGTGGAAAACTCAGAAAATTATTGGGAAAATCAAAATACCCACCAAAAAATCTCAAAGTTATATTTAACGATTTCCCCGGAGGACCCGAAAGTTTCGAGCTTATTTCAAGATTTTGCTACAACAATGGCAAAATCGTAATAAACCCCTACACCGCCCCTCGTCTTTTTTGTACCGCACA...

Protein

Download Protein FASTA

541 aa · LXL04_019818|LXL04_019818|OH1004|PROTEIN

MDASCDLEVDVNGEETFFVHEKVVSSYCGKLRKLLGKSKYPPKNLKVIFNDFPGGPESFELISRFCYNNGKIVINPYTAPRLFCTAHYMEMNETVTGSHNLVEKTEKFLEEMKFWSWPELLYALKYVVVSSKILQNCLDSLVARLIFAESTPSCPSISSPESSGLRLSTDSKSTESGQTQTRFLRSTWWFEDLVKVLTPDLVKSFVKSIVFHNFDHGVTSRFLVYYHKSRFPTAGPKEKREITESVIDSLCLLNQNSVSC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019818`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019818

Location Chr04:40896777-40899779 (+)

Description Similar to At3g22104: BTB/POZ domain-containing protein At3g22104

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22104`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g19850`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g50280`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g08570`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g50840`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019818 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009737 response to abscisic acid Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0031463 Cul3-RING ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT1G50280

ath:AT3G08570

ath:AT3G19850

ath:AT3G22104

ath:AT3G50840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.655

Rank 1 · LXL04_019818 · OH-1004

Cytoplasm0.293

Rank 2 · LXL04_019818 · OH-1004

Cell membrane0.097

Rank 3 · LXL04_019818 · OH-1004

Endoplasmic reticulum0.041

Rank 4 · LXL04_019818 · OH-1004

Lysosome / Vacuole0.023

Rank 5 · LXL04_019818 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03000.20NPH3187-413 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019818	`PF03000.20`	NPH3	187	413	1.2e-57	196.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5J4`	Arabidopsis thaliana	BTB/POZ domain-containing protein At3g22104	44.828%	Swiss-Prot	moderate database homology
`Q9LT24`	Arabidopsis thaliana	BTB/POZ domain-containing protein At3g19850	32.297%	Swiss-Prot	moderate database homology
`Q8RXR6`	Arabidopsis thaliana	BTB/POZ domain-containing protein At1g50280	33.947%	Swiss-Prot	moderate database homology
`Q9C9Z7`	Arabidopsis thaliana	BTB/POZ domain-containing protein At3g08570	28.495%	Swiss-Prot	weak database homology
`Q8LPQ3`	Arabidopsis thaliana	BTB/POZ domain-containing protein At3g50840	30.165%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card