TkA08G142760 | RubberDandelionOmics

Gene overview

TkA08G142760

Reference: TK1151 Chr: Chr08 Coordinates: 37194210-37199588 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3180 bp · TkA08G142760|TK1151|cDNA

ATGGGTGTGGATTTAGATTCTCTTGTTGCTGAATCCCGATTCAAGAAAAGAAAAGTAACATTAGGTTGCAATAACTGTTCTTCACCTTCCTCAATCTCTCACAATATTCAAACTTTCTTACCCACCCTTCGAGCTTCTGATTATTTTACCGAACCTTCATTGACCGAATTGACCAAGAGAGAACTCATGGACCCCGGTCATTCCCAAAGGGTTCAAAACTTTACAGTTGGTAGATACGGTTATGGAAAAGTCAAATTTTT...

CDS

Download CDS FASTA

3180 bp · TkA08G142760|TK1151|CDS

ATGGGTGTGGATTTAGATTCTCTTGTTGCTGAATCCCGATTCAAGAAAAGAAAAGTAACATTAGGTTGCAATAACTGTTCTTCACCTTCCTCAATCTCTCACAATATTCAAACTTTCTTACCCACCCTTCGAGCTTCTGATTATTTTACCGAACCTTCATTGACCGAATTGACCAAGAGAGAACTCATGGACCCCGGTCATTCCCAAAGGGTTCAAAACTTTACAGTTGGTAGATACGGTTATGGAAAAGTCAAATTTTT...

Protein

Download Protein FASTA

1059 aa · TkA08G142760|TK1151|PROTEIN

MGVDLDSLVAESRFKKRKVTLGCNNCSSPSSISHNIQTFLPTLRASDYFTEPSLTELTKRELMDPGHSQRVQNFTVGRYGYGKVKFFGETDVRWLDLDQIIKFKRHEIIVYEDETCKPVIGQGLNKPAEVTLLLQIKSLKSQVLEKLKVSAERQGAEFISFNSDKKEWKFTVQHFSRFGLSDNEEEDIAMDDANSDSDSEVQEPIPMLDSDGSDPHLLSHSLPSHLGLDPIRMKEMQMVMFPNEEEYEDQEQEQELNESF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G142760`
TK1151 ID	TkA08G142760
OH-1004 ID	LXL04_032028
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G142760

Location Chr08:37194210-37199588 (-)

Description Similar to NUP96: Nuclear pore complex protein NUP96

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80680`	Contributes to the transfer of mature mRNA from the nucleus to the cytosol.	A putative nucleoporin 96 Is required for both basal defense and constitutive resistance responses mediated by suppressor of npr1-1,constitutive 1.2005 · DOI: 10.1105/tpc.104.029926 The Arabidopsis SUPPRESSOR OF AUXIN RESISTANCE proteins are nucleoporins with an important role in hormone signaling and development.2006 · DOI: 10.1105/tpc.106.041566 MOS11: a new component in the mRNA export pathway.2010 · DOI: 10.1371/journal.pgen.1001250 Putative members of the Arabidopsis Nup107-160 nuclear pore sub-complex contribute to pathogen defense.2012 · DOI: 10.1111/j.1365-313x.2012.04928.x
`At1g10390`	Nuclear pore complex protein NUP98A.	No verified direct reference in this release
`At1g59660`	Nuclear pore complex protein NUP98B.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032028 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000973 post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery Biological Process

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006405 RNA export from nucleus Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0006508 proteolysis Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0006952 defense response Biological Process

GO:0006999 nuclear pore organization Biological Process

GO:0009733 response to auxin Biological Process

GO:0015031 protein transport Biological Process

GO:0034398 telomere tethering at nuclear periphery Biological Process

KEGG gene cross-reference

ath:AT1G10390

ath:AT1G80680

hsa:4928

mmu:269966

rno:81738

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.830

Rank 1 · TkA08G142760 · TK1151

Cytoplasm0.217

Rank 2 · TkA08G142760 · TK1151

Cell membrane0.032

Rank 3 · TkA08G142760 · TK1151

Mitochondrion0.030

Rank 4 · TkA08G142760 · TK1151

Endoplasmic reticulum0.019

Rank 5 · TkA08G142760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05137PilN35-76 aa

PF04096Nucleoporin246-180 aa

PF05137PilN441-462 aa

PF12110Nup96528-812 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G142760	`PF05137`	PilN	35	76	0.002	18.8
TkA08G142760	`PF04096`	Nucleoporin2	46	180	1.6e-37	129.6
TkA08G142760	`PF05137`	PilN	441	462	0.002	18.8
TkA08G142760	`PF12110`	Nup96	528	812	4.3e-72	243.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LLD0`	Arabidopsis thaliana	sp\|Q8LLD0\|NUP96_ARATH Nuclear pore complex protein NUP96	54.200%	Swiss-Prot	High
`Q8RY25`	Arabidopsis thaliana	sp\|Q8RY25\|NU98A_ARATH Nuclear pore complex protein NUP98A	53.000%	Swiss-Prot	Low
`F4ID16`	Arabidopsis thaliana	sp\|F4ID16\|NU98B_ARATH Nuclear pore complex protein NUP98B	45.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card