Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3180 bp · LXL04_032028|LXL04_032028|OH1004|cDNA
ATGGGTGTGGATTTAGATTCTCTTGTTGCTGAATCCCGATTCAAGAAAAGAAAAGTAACATTAGGTGGCAATAACTGTTCTTCACCTTCCTCAATCTCTCACAATATTCAAACTTTCTTACCCACCCTTCGAGCTTCTGATTATTTTACCGAACCTTCATTGACCGAATTGACCAAGAGAGAACTCATGGACCCCGGTCATTCCCAAAGGGTTCAAAACTTTACAGTTGGTAGATACGGTTATGGAAAAGTCAAATTTTT...
3180 bp · LXL04_032028|LXL04_032028|OH1004|CDS
ATGGGTGTGGATTTAGATTCTCTTGTTGCTGAATCCCGATTCAAGAAAAGAAAAGTAACATTAGGTGGCAATAACTGTTCTTCACCTTCCTCAATCTCTCACAATATTCAAACTTTCTTACCCACCCTTCGAGCTTCTGATTATTTTACCGAACCTTCATTGACCGAATTGACCAAGAGAGAACTCATGGACCCCGGTCATTCCCAAAGGGTTCAAAACTTTACAGTTGGTAGATACGGTTATGGAAAAGTCAAATTTTT...
Protein
Download Protein FASTA1059 aa · LXL04_032028|LXL04_032028|OH1004|PROTEIN
MGVDLDSLVAESRFKKRKVTLGGNNCSSPSSISHNIQTFLPTLRASDYFTEPSLTELTKRELMDPGHSQRVQNFTVGRYGYGKVKFFGETDVRWLDLDQIIKFKRHEIIVYEDETCKPVIGQGLNKPAEVTLLLQIKSLKSQVLEKLKVSAERQGAEFISFNSDKKEWKFTVQHFSRFGLSDNEEEDIAMDDANSDSDSEVQEPIPMLDSDGSDPHLLSHSLPSHLGLDPIRMKEMQMVMFPNEEEYEDQEQEQELNESF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_032028 |
|---|---|
| TK1151 ID | TkA08G142760 |
| OH-1004 ID | LXL04_032028 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_032028 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:15202472-15206740 (-) | |||||||||
| Description | Similar to NUP96: Nuclear pore complex protein NUP96 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000973 post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery Biological Process GO:0002758 innate immune response-activating signaling pathway Biological Process GO:0006405 RNA export from nucleus Biological Process GO:0006406 mRNA export from nucleus Biological Process GO:0006508 proteolysis Biological Process GO:0006606 protein import into nucleus Biological Process GO:0006913 nucleocytoplasmic transport Biological Process GO:0006952 defense response Biological Process GO:0006999 nuclear pore organization Biological Process GO:0009733 response to auxin Biological Process GO:0015031 protein transport Biological Process GO:0034398 telomere tethering at nuclear periphery Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G10390 ath:AT1G80680 hsa:4928 mmu:269966 rno:81738 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04096.21Nucleoporin246-180 aaPF12110.14Nup96528-812 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_032028 | PF04096.21 | Nucleoporin2 | 46 | 180 | 1.6e-37 | 129.6 |
| LXL04_032028 | PF12110.14 | Nup96 | 528 | 812 | 4.3e-72 | 243.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.