TkA08G138740 | RubberDandelionOmics

Gene overview

TkA08G138740

Reference: TK1151 Chr: Chr08 Coordinates: 36083735-36085288 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1142 bp · TkA08G138740|TK1151|cDNA

TTGCATTGAGAGCACCCTCGATCCATTGCTATATATATAAAGGCTCGCCTTATGTTCCCTACTTATACTCAAGAATTAACCTTTTTCATTCGCCTTAAAATCTTTTGAAACCTCATGTCTATTGACGATAAGAAGTATGCACAAAACGCTGCTTTTGATATTAAAGAAAAGCTCAATTTTGTGAGAGATGGAGCAATCAAATTGCCACCAGGGTTTAGGTTTCAACCCACCGATCAAGAGATTGTGTTCCAATATCTGGT...

CDS

Download CDS FASTA

789 bp · TkA08G138740|TK1151|CDS

ATGTCTATTGACGATAAGAAGTATGCACAAAACGCTGCTTTTGATATTAAAGAAAAGCTCAATTTTGTGAGAGATGGAGCAATCAAATTGCCACCAGGGTTTAGGTTTCAACCCACCGATCAAGAGATTGTGTTCCAATATCTGGTTCGTAAAGTCTTCTCTTGTCCCTTGCCTGCCTCTATCATCCCAGAAATTGTCAACATTTGCAACTTCAATCCTTGGGATTTGCCAGGGGAGTGGGAGCAAGAAAGATACTTCTT...

Protein

Download Protein FASTA

262 aa · TkA08G138740|TK1151|PROTEIN

MSIDDKKYAQNAAFDIKEKLNFVRDGAIKLPPGFRFQPTDQEIVFQYLVRKVFSCPLPASIIPEIVNICNFNPWDLPGEWEQERYFFSKKEAKYGQGSRVNRKSGDGYWKATGFDKHVTRCCGNNSVLKKKETITGMKKTLVFYKSKPSTTRTHWIMHEYRLVHSPPSSTTTTTNDKKSWIQMGNWVLCHVLLNKRSRKPFEDDIGKRLGSQEQLMHPNITREDVISINCDEAASSSSSCGSSVVTQEESSSREPLDYEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G138740`
TK1151 ID	TkA08G138740
OH-1004 ID	LXL04_031963
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G138740

Location Chr08:36083735-36085288 (+)

Description Similar to NAC083: NAC domain-containing protein 83

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13180`	Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation.	VND-INTERACTING2, a NAC domain transcription factor, negatively regulates xylem vessel formation in Arabidopsis.2010 · DOI: 10.1105/tpc.108.064048 The Arabidopsis NAC transcription factor VNI2 integrates abscisic acid signals into leaf senescence via the COR/RD genes.2011 · DOI: 10.1105/tpc.111.084913 Arabidopsis thaliana NAC083 protein interacts with Mungbean yellow mosaic India virus (MYMIV) Rep protein.2014 · DOI: 10.1007/s11262-013-1028-6
`At2g33480`	Transcription activator of the mannan synthase CSLA9.	No verified direct reference in this release
`At3g15510`	Transcription factor of the NAC family (Probable).	NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.2008 · DOI: 10.1105/tpc.108.060160
`At1g52880`	May encode a transcription factor involved in the elaboration of shoot apical meristems (SAM) (Probable).	NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.2008 · DOI: 10.1105/tpc.108.060160
`At1g77450`	Transcriptional activator that positively regulates age-dependent senescence, dark-induced leaf senescence and stress-induced senescence.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031963 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009831 plant-type cell wall modification involved in multidimensional cell growth Biological Process

GO:0010089 xylem development Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G61110

ath:AT2G33480

ath:AT5G13180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.957

Rank 1 · TkA08G138740 · TK1151

Cytoplasm0.098

Rank 2 · TkA08G138740 · TK1151

Cell membrane0.038

Rank 3 · TkA08G138740 · TK1151

Endoplasmic reticulum0.025

Rank 4 · TkA08G138740 · TK1151

Plastid0.014

Rank 5 · TkA08G138740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365NAM31-162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G138740	`PF02365`	NAM	31	162	2.1e-39	135.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FY93`	Arabidopsis thaliana	sp\|Q9FY93\|NAC83_ARATH NAC domain-containing protein 83	55.200%	Swiss-Prot	Medium
`O22798`	Arabidopsis thaliana	sp\|O22798\|NAC41_ARATH NAC domain-containing protein 41	52.700%	Swiss-Prot	Medium
`Q9LD44`	Arabidopsis thaliana	sp\|Q9LD44\|NAC56_ARATH NAC transcription factor 56	44.200%	Swiss-Prot	Medium
`Q9ZNU2`	Arabidopsis thaliana	sp\|Q9ZNU2\|NAC18_ARATH NAC domain-containing protein 18	47.100%	Swiss-Prot	Medium
`Q9CAR0`	Arabidopsis thaliana	sp\|Q9CAR0\|NAC32_ARATH NAC transcription factor 32	39.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card