Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2171 bp · TkA08G080190|TK1151|cDNA
TTGGAAGCGGGGGGTTAAAATCAAGAAGAAGAAAAACGAAGGTATATATACAGATGCAGAGGGCCGAGAATCATTCGAGAAGAATTCTAAGAGAGAGAAACCAACGACCAAAATTGCGTATTACCTCTATACGTATACGAATTTCGCAGCGCCTTTTTTCAATTTCTTCAACCTCCCCATTTCTTCCCTTTTTGCTTCTTCCGATTGATTTTCTTTCGTCAATGCAAGTTTAAGTTTTTCAGAGAATCATATTCTTCGGC...
1590 bp · TkA08G080190|TK1151|CDS
ATGGATTCAGCAAGAAGTTGGCTGCATAAATTTCAACCTAGAGAACGGTTGAGATCAAACACCAGAAGACGAGATTCAAATAGCGATGGCGAAGATTCAAATCACCCAATCATGGACGAAGAAGCCTCAAATATCACAAAACAAAAAGTCGCTGCAGCTAAACAGTACATCGAGAACCATTACAAGGAACAAATGAAGAATTTACAGGAAAGAAGAGAACGGCGAATCTTACTCGAGCAGAAATTAGCCGACGGCGATGT...
Protein
Download Protein FASTA529 aa · TkA08G080190|TK1151|PROTEIN
MDSARSWLHKFQPRERLRSNTRRRDSNSDGEDSNHPIMDEEASNITKQKVAAAKQYIENHYKEQMKNLQERRERRILLEQKLADGDVSEEDQNNLLRFLEKKETEYMRLQRHKMGVDDFELLTMIGKGAFGEVRICREKTTGTVYAMKKLKKSEMLRRGQVEHVKAERNLLAEVDSNCIVKLYCSFQDNEYLYLIMEYLPGGDMMTLLMRKDTLTENEAQFYVAETVLAIESIHKHNYVHRDIKPDNLLLDKYGHLRLSD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G080190 |
|---|---|
| TK1151 ID | TkA08G080190 |
| OH-1004 ID | LXL04_018736 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 94.633Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G080190 |
|---|---|
| Location | Chr08:20583002-20587351 (-) |
| Description | Similar to STK38L: Serine/threonine-protein kinase 38-like |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000077 DNA damage checkpoint signaling Biological Process GO:0006468 protein phosphorylation Biological Process GO:0006974 DNA damage response Biological Process GO:0007165 signal transduction Biological Process GO:0010507 negative regulation of autophagy Biological Process GO:0010508 positive regulation of autophagy Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0036211 protein modification process Biological Process GO:0043407 negative regulation of MAP kinase activity Biological Process GO:0051012 microtubule sliding Biological Process GO:0051128 regulation of cellular component organization Biological Process GO:0099173 postsynapse organization Biological Process |
| KEGG gene cross-reference | dpo:4813412 hsa:11329 hsa:23012 mmu:232533 pon:100173048 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12330Haspin_kinase23-264 aaPF00069Pkinase43-78 aaPF00069Pkinase120-271 aaPF07714PK_Tyr_Ser-Thr120-267 aaPF01636APH166-236 aaPF03109ABC1193-269 aaPF14531Kinase-like230-262 aaPF07387Seadorna_VP7230-260 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G080190 | PF12330 | Haspin_kinase | 23 | 264 | 0.0053 | 16.6 |
| TkA08G080190 | PF00069 | Pkinase | 43 | 78 | 1.5e-64 | 218.6 |
| TkA08G080190 | PF00069 | Pkinase | 120 | 271 | 1.5e-64 | 218.6 |
| TkA08G080190 | PF07714 | PK_Tyr_Ser-Thr | 120 | 267 | 9.4e-30 | 104.5 |
| TkA08G080190 | PF01636 | APH | 166 | 236 | 0.0045 | 17.5 |
| TkA08G080190 | PF03109 | ABC1 | 193 | 269 | 1.8e-06 | 28.0 |
| TkA08G080190 | PF14531 | Kinase-like | 230 | 262 | 0.024 | 14.6 |
| TkA08G080190 | PF07387 | Seadorna_VP7 | 230 | 260 | 0.034 | 13.9 |
| TkA08G080190 | PF01636 | APH | 239 | 256 | 0.0045 | 17.5 |
| TkA08G080190 | PF00069 | Pkinase | 314 | 417 | 1.5e-64 | 218.6 |
| TkA08G080190 | PF07714 | PK_Tyr_Ser-Thr | 320 | 382 | 9.4e-30 | 104.5 |
| TkA08G080190 | PF14531 | Kinase-like | 335 | 353 | 0.024 | 14.6 |
| TkA08G080190 | PF12330 | Haspin_kinase | 373 | 421 | 0.0053 | 16.6 |
| TkA08G080190 | PF00433 | Pkinase_C | 436 | 480 | 3.4e-09 | 38.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.